Detailed information on CNT30103060


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690289Oryza rufipogonOryza sativa15.2254.5989.08119forward
CNT30106405Oryza rufipogonOryza longistaminata54.2219.4599.76424reverse complement
CNT30117467Oryza rufipogonOryza nivara10073.9899.36782forward

Expression of CNT30103060

Peptides detected in this lncRNA

>peptide 1 (65 aa)
QRPFAWKRMREKERGTLVRVGRGILVFSKNTNNTIHGLSNVSNGNLTGEAWKGSKRNFRGTQRIV*

>peptide 2 (34 aa)
MVGLDKVVNGLEKYTWRWTVASLNQVPTDPPVYC*

Sequence

>CNT30103060
CAGAGGCCGTTCGCGTGGAAGAGGATGCGGGAGAAGGAAAGGGGAACTTTAGTTAGGGTTGGCAGGGGCATTTTGGTATTTTCTAAAAATACTAACAACA
CAATACACGGTTTGAGCAACGTATCTAATGGAAACCTAACGGGAGAGGCATGGAAGGGATCAAAACGAAATTTCAGGGGTACACAGAGGATCGTGTAAAA
TTCGAGGGTATAGAAAATATTAGGTGAGTTTTCATGTGTACATAAGGGATTTACTCAAAGAAGAATGGCATTTCAGATTCAGCTTATGCGACATTTCCTG
GCTCATGCTTCCGTGGCTGGGTGACAGCAGCCGAAGGAGCCTTTACAAGTTGCAAAAATTTAGGAACATAATATGATTTTATTTTGCACACAACTCTCCC
ATACAAAGACCATATAATAGAGGCGATTCCAATTAGGATCTAACCAGCGCACAAGGTATAGGACTACCACGAAGGCACAAACTATGGGTGGTTTAACTCT
TACGTTGCCACTAAACATTAAGTGCTAAAAATACAATCATCGTGATCTTTTTACATTATTTTTTGTATAGCTTGAATCAAAGTGGATTTTTCTAATATTT
TCTACAAGAATTGTGAAGAAAAGAATTACTTTATTTAGCTTGAATCAAACTGGTTTGTACTCACTGGAAACTAATGGTAGGACTGGACAAAGTTGTAAAT
GGGTTAGAAAAATATACTTGGAGATGGACCGTGGCTAGCTTGAATCAGGTACCAACCGATCCACCTGTTTATTGCTGACCAG