Detailed information on CNT30103047


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000207, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30596083Oryza rufipogonOryza meridionalis20.9573.9794.43287reverse complement

Expression of CNT30103047

Peptides detected in this lncRNA

>peptide 1 (99 aa)
NPCATVHLPAQAEPSQPCPCPIAADPLPKSGHLVAPFSKLVAAMESSQSPLPFPQEIPKSFYGNPFLFRGSIFPFSSVNPSLSQSFSLIWARTRAPVPI*

>peptide 2 (80 aa)
QSLRHCSSSSSGRAEPAVPVSYCRRSPSKVRPPRCSFFQISCGNGILSISSSFSPRNPQKFLWKSFPISWFNLSFFQRKP*

>peptide 3 (40 aa)
PIPAPLFIFQLRQSRASRARVLLPPIPFQSPATSLLLFPN*

>peptide 4 (34 aa)
MLMVWRIRCSPGQAACGVESSAPFILFFRCLDLY*

Sequence

>CNT30103047
CCAATCCCTGCGCCACTGTTCATCTTCCAGCTCAGGCAGAGCCGAGCCAGCCGTGCCCGTGTCCTATTGCCGCCGATCCCCTTCCAAAGTCCGGCCACCT
CGTTGCTCCTTTTTCCAAATTAGTTGCGGCAATGGAATCCTCTCAATCTCCTCTTCCTTTTCCCCAAGAAATCCCCAAAAGTTTCTATGGAAATCCTTTC
CTATTTCGTGGTTCAATCTTTCCTTTTTCCAGCGTAAACCCTAGTCTTTCCCAAAGTTTCTCGTTGATTTGGGCCCGGACCCGAGCTCCCGTGCCTATAT
AAAGGACCCCCTAGTCGTCCTCTACCTATCCCCTCAAGTCCCGTCTTCCGCCGTCGCCGGTCAGCGCCGCCACCTCCCTCGGCACCGCAAAGTCGAGCTC
TATCCCGATCGCTGGTTATTTTGCGCCAAATCCCACCGGAGGTTGCCCGTCGTCGTGAACCGGAGCGCCGCCGCTGCCGCCGTTGGGTTCGCGAGGAGGA
GAAGAAGATCGTCCTCCACTTCCCCGAAGCTGAAATCCACCGGAGCTCCATCGTCGCCGTCAACCCGAAGTTCGCCGTCGAGTTTTGATCTCCGGCGAGG
CCCTACTGCTCATCCCGTCGTCGCCTTCGGTCGCCGTCGTCTCCATTGGGTTCGCAGGAGCAAGGTGAAGCCCGGCCACCGGGTTTTCTTCGCCGAAGAT
CGCTGAAACGTCGCCGCCATTGCTGACCCGACCCCATCGCCGCCTCTACCTCGTTGCCGGACGTCTGCCGTCATCATCCATCGTCGCGCCGCCCCTCGCA
TGTAGTTTCTGTCGTTTCGAAGGTTCGCGAGTGCGCCGGAAGTGTTCAAGAAGATTAATTGAAGACCGATTATTGCAAGAGGAAGGGTTCTACAGTGATG
CTGATGGTGTGGAGGATTAGGTGTAGCCCTGGTCAAGCTGCCTGTGGAGTGGAGTCGTCTGCGCCGTTTATCTTATTTTTCCGCTGCTTAGATCTTTATT
GATTGAGAGGAACTATCTACCTCTGTAATGACATTTTATTCGCTTATTAATTAGAGTAGTATTTGTACTCTATTATCAATTTGTTATTGTGTGCCTCGGC
TGATTCCTGGACGAGTGTTCACACACATGTAAGCGTTTGGAATTTTGGATAGAAATTCTGGGCGTGACAAGTTGGTATCAGAGCCCCCTTGACCCTAGGT
TATGCCAAACGGTTACCCATAGAAGCCCTCTAAAAATATTGGAAAAGTAGAACTGTTCTCCTCCCCTTCTCTTTTAATTAAACCAAACTAATAGCACATG
CAATTCATAATCTCTTTTAGTGGTTCTCGTTCAAAATTTATTCCAGCGTTATTAGTACTGTACATCTATT