Detailed information on CNT30102949


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695974Oryza rufipogonOryza sativa56.1610094.83561forward
CNT30553947Oryza rufipogonOryza glaberrima17.9222.7289.39179forward
CNT30597242Oryza rufipogonOryza meridionalis31.0363.5293.87310forward
CNT30109911Oryza rufipogonOryza longistaminata33.7354.6295.25337forward
CNT30575755Oryza rufipogonOryza barthii26.63103.9192.11266forward
CNT30117497Oryza rufipogonOryza nivara58.4656.5398.8584forward

Expression of CNT30102949

Peptides detected in this lncRNA

>peptide 1 (98 aa)
ERASSSSPSPPATVLNPIGRPTFSPSRPCLVSRKNRGTPPRIRRERRRHLRRRREKSSTPSQSANLRERDRVNSEHRRALDAAASPLLVARLPQFVTS*

>peptide 2 (38 aa)
MTTVAAAPSPNQYTVAKTSPSRICCLTIRSRVLRRPTL*

>peptide 3 (96 aa)
GRGRAPPLHLRRRPYLTRSADQLSLPLALVSFRGRTEVPHLGFAGNGGAISDAGERSPRLRRNPPIFGNATASTRNTVALWTPLLRLCSSPGFHSS*

Sequence

>CNT30102949
GGGAGAGGGCGAGCTCCTCCTCTCCATCTCCGCCGGCGACCGTACTTAACCCGATCGGCCGACCAACTTTCTCTCCCTCTCGCCCTTGTCTCGTTTCGCG
GAAGAACCGAGGTACCCCACCTCGGATTCGCCGGGAACGGAGGCGCCATCTCCGACGCCGGCGAGAGAAGTCCTCGACTCCGTCGCAATCCGCCAATCTT
CGGGAACGCGACCGCGTCAACTCGGAACACCGTCGCGCTCTGGACGCCGCTGCTTCGCCTTTGCTCGTCGCCCGGCTTCCACAGTTCGTGACAAGCTGAG
CCACCTCGCCACGAGTTTCATCAACCCCTGTAGATCAAGAATCCCGAAGGAATCGACGCAAGGTGGACCACGGTGGGAGATCCTCTTCTTCTTCCCCAAC
TCCGGCCGCCGACGCCATTCCTTTCTTTCTCCTTCTCTGTAGAAGCCTGGGGGTACACCGTCGATGACGACCGTAGCAGCCGCGCCGTCGCCGAACCAGT
ACACCGTCGCCAAGACTTCGCCGAGCCGTATTTGCTGCTTGACGATTCGCAGCCGAGTCTTGAGGAGGCCTACTTTGTAGCTGAGCAAGGAGTGGAAGAG
CAAGGTGAGATCACTCCTGAGGAGGATGATTTTGATGGGGAAGTTTCTTTCTTCTAGGATGGTTCTTACTTGGGTTTACCCTAATCGGTTGCATGAAAGA
TCATTTGGGTAGAAGATGCTTCCGCGAACCTAACTATTCGGCCAATTATGTATCTAAGTTATAAGTTGTTCGAACCTAACCTAGAATCTAGAACTTAAAA
CTTAGAACTCCCTAAGTTGAGATATCATGTACTTGGATGAAAGTGTTTAGTGTGTTCCTTTTGTTAGGGACATATTAAACATGAGTATGAGTTAAAGATA
TTTGAGATGTTGTAGATCTTTAGCCAATTTTGTCAAGTCTTCTGATTGTGTAACACATCTGGTCGACGCCTTCGAGTGGTTTGACGGGCACATCTCAGG