Detailed information on CNT30102896


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554585Oryza rufipogonOryza glaberrima95.794.8199.51205forward
CNT30467492Oryza rufipogonSaccharum spontaneum25.76.289.0955forward
CNT30133470Oryza rufipogonLolium perenne22.92.1389.849forward
CNT3067880Oryza rufipogonLeersia perrieri34.119.2195.8973forward
CNT30338549Oryza rufipogonEragrostis tef27.15.8691.3858forward
CNT30596772Oryza rufipogonOryza meridionalis68.226.797.95146forward
CNT30105381Oryza rufipogonOryza longistaminata102.3428.2692.24219forward
CNT30577470Oryza rufipogonOryza barthii78.58.62100168forward
CNT30584750Oryza rufipogonEchinochloa crusgalli26.646.491.2357forward
CNT30117421Oryza rufipogonOryza nivara67.2912.62100144forward
CNT30594786Oryza rufipogonEragrostis curvula27.14.5289.6658forward
CNT30558140Oryza rufipogonPanicum hallii23.836.5890.251forward

Expression of CNT30102896

Peptides detected in this lncRNA

>peptide 1 (70 aa)
SIIDKLVVVVPCGAAPATRRAMPPLLRPPDLGFYWSRRAQRPADHGRGRGDQICNWGQQARGGNCIICKKL

Sequence

>CNT30102896
AGCATAATAGATAAACTCGTTGTCGTCGTGCCGTGCGGTGCGGCCCCCGCTACCCGCCGCGCGATGCCCCCTCTTCTCCGCCCGCCTGATCTAGGGTTTT
ACTGGAGCCGCCGCGCGCAGCGACCAGCCGACCACGGACGAGGACGAGGGGATCAGATATGCAATTGGGGGCAGCAAGCTAGAGGTGGCAACTGCATAAT
TTGCAAGAAATTAT