Detailed information on CNT30102828


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006694, E-value = 8e-120

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696135Oryza rufipogonOryza sativa29.7165.899.01202forward
CNT30553865Oryza rufipogonOryza glaberrima24.7165.8895.83168forward
CNT30117152Oryza rufipogonOryza nivara2537.6998.82170forward

Expression of CNT30102828

Peptides detected in this lncRNA

>peptide 1 (77 aa)
GFDPLVLLYLSPQETEQFVEYFIRIEFVLILSLKPSLDFSRVDSSRLEFDLFNPMLYKGPPRRPLSFAPSPVLSRAP*

>peptide 2 (29 aa)
GVLILSFSSIFPLKKRSNSLSILSESSSF*

Sequence

>CNT30102828
GGGGTTTTGATCCTCTCGTTCTCCTCTATCTTTCCCCTCAAGAAACGGAGCAATTCGTTGAGTATTTTATCCGAATCGAGTTCGTTTTGATTTTATCCCT
AAAACCGAGTTTGGATTTTTCCCGAGTCGATTCCTCTCGTTTGGAGTTCGATCTCTTCAATCCAATGCTATATAAAGGACCACCTCGTCGCCCTCTTTCG
TTTGCCCCCTCTCCCGTCCTCTCCCGTGCACCGTAGCCTCGTCGCCGCGTGCACTTAGGTCGCCGCCGCCGCCGGCCGTCTTCAGCCGCGCCGCGCCGCC
GCCTCCGCCGTCGCCGCCGCTTGCCGTCGCCGCCGTTAGGTGCGCCGTGGTGAGAGGAACCTCGGCCGCCCGTCCTTCTTTGCCGCCGGTCGCCGTAGCT
CGCCGTCGCCGCGCAAGCCGAACCGCCGCCACCGCCTTCTCGTCGCCGGCCGTCGTCGTGCGTCGTTTGTCGTTGTGTTTCCGACGTTCCGGAGGAGAGC
GTTTCCTTTGAGGAAGGTTCCGAAGCGTTTGCGGAAGCCCAAGAAGAGGAGTATCTCAGTGAAGGTGATGATCTGGAGGATTAGGCTTGTTCTTGGTTAA
GATGCCTGTGGAGTGGAGTCGCCATAGCTGTTCCGTAGTTTGTTATCGTTTTATATTTCCGCTGCGTAGAATGTTATTCT