Detailed information on CNT30102730


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554323Oryza rufipogonOryza glaberrima24.8527.82100207forward
CNT30596616Oryza rufipogonOryza meridionalis22.3316.0898.92186forward

Expression of CNT30102730

Peptides detected in this lncRNA

>peptide 1 (31 aa)
NTDQPTLSTAITEKKYSQTAPAWMRKKMTDL*

>peptide 2 (78 aa)
MAGRASSSWPAPARVRRAWWGWWRAPRRRGKEATRREPRPGETRPAAGWPWPPWAPGRVPWWTWWVALWSEPGWWAPRR

>peptide 3 (57 aa)
MVAGASAAGEGGDATGASTGGDEAGGGVALAALGAGAGALVDLVGGALVGAGVVGASA

>peptide 4 (32 aa)
MAIAQSSNVVGRVVKPKPKPKLRSLLLLPPVP*

Sequence

>CNT30102730
AACACAGACCAGCCCACGCTCTCAACAGCCATCACAGAGAAAAAGTATAGCCAGACAGCACCAGCATGGATGAGAAAAAAGATGACAGATCTATGATCCG
GGCAAAGATGGAATAATACAATGAATCAATGATGATGATGACAGCAACATAAAATAAATTAAAAGTAGATGATCTCAGTGGTACAGTACAAGGGCGGGCA
GGCAGCAGCTAGCAGAGTCATATCGTGGGCGTAGCAGAGAGAAGAAGAAGAAGAAAGAAACAAAAGAATCCGAGGCATGGCGATCGCTCAATCATCAAAT
GTGGTTGGGAGAGTGGTAAAGCCAAAGCCAAAGCCAAAGCTAAGGTCCCTCCTCCTCCTCCCTCCCGTCCCGTAAAAGAATCGACGAGCAAAATACAGCG
CAAAATGTGGTGGGGCGCACCGGCCGCTGCCATCTGCGTCGTCGTCGTTGCTCACGTCGTTGCACGACGCCGTTTTGCTTAGGCGAGGAGGGCGACGAGG
CGGCGGGGGCCTTAGCCTTCTTGGAGTGCTTGGGGGACTCGGCGACGGCGACGGGGGCCGGGGCGGGGGCCTTGGAGCTCTTCTTCTTCTTCTTGGATGG
CGGGGAGGGCTTCTTCTTCTTGGCCGGCGCCGGCGCGGGTGCGTCGGGCTTGGTGGGGATGGTGGCGGGCGCCTCGGCGGCGGGGGAAGGAGGCGACGCG
ACGGGAGCCTCGACCGGGGGAGACGAGGCCGGCGGCGGGGTGGCCTTGGCCGCCTTGGGCGCCGGGGCGGGTGCCTTGGTGGACTTGGTGGGTGGCGCTT
TGGTCGGAGCCGGGGTGGTGGGCGCCTCGGCGG