Detailed information on CNT30102722


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30102722

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MVNSVQSYTKAFRHKKEEVTYLVHKVRKIVKRLSF

>peptide 2 (29 aa)
MIPTAAKTSNAKPCKKTMAFSSSITNHKK*

>peptide 3 (62 aa)
MNRMGELLKTIPAFMFPMAKEEDMHSLEGVHWGCLFKQYDIAAYCALKVKSSVLIYYLIKLV*

>peptide 4 (55 aa)
MQNPAKRQWHSVAQSLIIRNEQNGRTIKNYSSFYVSHGKRGRHALFRRCPLGMSL*

>peptide 5 (45 aa)
MTVMRSHTTVPRRNRRSKLFRKSTSTLFNQTFRGMHHGKQCPKLH*

>peptide 6 (43 aa)
MVSILLENGEEDHFDDHQDILDCLLDVLHVQPEMVGLNDPYGS*

Sequence

>CNT30102722
CCAAGATCCTCTGTCCAACATGATATTGTGTACAACAAGACGAAACCACCACTTATTCAGGCACCTCTAGCTTTCTAATGATTGTAATGTACTTACTCTA
CTCGTGTGCATAAGAAACACTGAGTTTATAACACTGTGAGTCCATACAGAGAGATATCATACAAGAGCTGGAGGGTATTACTCAGTACAAAACCTGGATC
ATTCATTCTTCTTCTCGAATTTCGCCCTGTCAGCCCCGCTGTATGGAGCAACATGGTAAGCATATTGTTGGAGAACGGAGAAGAAGACCATTTCGATGAT
CACCAAGACATTCTGGATTGCCTCCTGGATGTGCTCCACGTCCAACCAGAAATGGTGGGACTGAATGATCCCTACGGCAGCTAAAACCTCTAATGCAAAA
CCCTGCAAAAAGACAATGGCATTCAGTAGCTCAATCACTAATCATAAGAAATGAACAGAATGGGAGAACTATTAAAAACTATTCCAGCTTTTATGTTTCC
CATGGCAAAAGAGGAAGACATGCACTCTTTAGAAGGTGTCCACTGGGGATGTCTCTTTAAGCAGTATGATATAGCAGCTTATTGTGCCTTAAAGGTGAAA
AGCTCAGTATTGATTTATTATCTAATTAAACTTGTTTAACAACTTACTCTGGCTTTCTTTCTAAACTAATTGGTAACAAGGCATATAGTTGTTCAGTTAT
GAGACTTCATAAAGGAAATTGCCAAATCTGACTTTCAAATGGCAGTTCATAAAACTTAAGTTGCAGAAGAACTTTTTCAATTCATAAACAACTATATGTA
CAAAAAGAAATGGTGGTGTATCTTGAGCACCTAATTAAATCCAGAGAATAAATATGATGAAGCTTCATGACTGTCATGAGAAGTCACACCACAGTACCCA
GAAGGAACAGAAGATCTAAACTATTTAGAAAGTCTACATCGACATTGTTCAATCAAACATTCAGAGGCATGCATCATGGTAAACAGTGTCCAAAGTTACA
CTAAAGCATTCAGACACAAGAAAGAAGAAGTAACCTATTTGGTCCATAAAGTAAGAAAAATTGTGAAACGGCTTTCATTTT