Detailed information on CNT30102620


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695229Oryza rufipogonOryza sativa34.2544.5488.5400forward
CNT30109186Oryza rufipogonOryza longistaminata51.846.498.35605forward
CNT30115521Oryza rufipogonOryza nivara40.7542.4698.32476forward

Expression of CNT30102620

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MMVDYLLDHCDVPLRFKDMHKSKVDIVANWRFW*

>peptide 2 (31 aa)
MELRQAALAIPVAVQSKDFHVACAKGQMPHG*

>peptide 3 (40 aa)
MCPFASRICINPRLTLWPTGDFGKILSCFTMAFHCLAHGI*

>peptide 4 (42 aa)
RHLAHGALSPKPDAMAGPSLRRPADPAGCLSNRESTDLSTAL*

>peptide 5 (51 aa)
KAPRAWSSFPEARRNGRSLAKAPSRSGRLPQQQRVHGPLHCSVRGSGLFCQ*

>peptide 6 (82 aa)
MKLIEYQWLLQQDVRTGKPSLDIFLAEMRRFEVLPSVKNCWNVTSLLLAPVYSRRAAASSPEPLSSPFAAGAEERNDGRLPS*

>peptide 7 (88 aa)
MSEVFHVFFLMKMIWSCGKLLWQSRLLSRVKIFMWLVLKGRCLMADNLQKRGGLIRRIAPYATWHFKMTPNLFVQCAFTNRIWRLLRS*

Sequence

>CNT30102620
AAGGCACCTCGCGCATGGAGCTCTTTCCCCGAAGCCAGACGCAATGGCCGGTCCCTCGCTAAGGCGCCCAGCAGATCCGGCCGGTTGCCTCAGCAACAGA
GAGTCCACGGACCTCTCCACTGCTCTGTAAGAGGATCTGGACTCTTCTGCCAATGAGGCCACTGTCTGATCCACCATGGTAGGGGATTCTTTCCGTTGCC
TGACGCTTTTGCTTACTAATTGGATCTGAATGCACCACATATCTTCCCCTCCGGAAATTATTTTTTTCGGATGAAATTGATAGAATACCAATGGCTGTTG
CAACAAGACGTGAGGACTGGCAAGCCATCTCTTGATATATTTCTTGCTGAGATGAGGAGGTTTGAGGTATTGCCATCAGTTAAAAATTGCTGGAATGTGA
CTTCGCTCCTCCTCGCTCCTGTGTACAGCCGCCGCGCCGCCGCATCCTCGCCGGAGCCGCTTTCTTCTCCGTTCGCCGCCGGAGCCGAGGAACGAAATGA
TGGTCGACTACCTTCTTGATCACTGCGATGTGCCCCTTCGCTTCAAGGATATGCATAAATCCAAGGTTGACATTGTGGCCAACTGGAGATTTTGGTAAAA
TCCTATCATGTTTCACCATGGCATTTCACTGTTTGGCGCACGGTATTTAGGAGCTATTTGTATAGTAAATGCTGGAATATTGAAGTAAATTATATGTTCA
GCTTATTAACTGCATTGCGATAAGCTTTGATCTAGAGCCGGTTTCAATTTTCATTTGTGTGGTCGCATCCTTTAATTTATATAGCTTCATAAGAGTATAA
TCCGAAGTACATGCCGCTTTATGTATTTTTATGCCTTCATATTCTGATTGTCTAATGGCTCTAAAACAACAGACATAAACTACGATGTCTGAAGTTTTCC
ATGTTTTCTTCCTTATGAAAATGATATGGAGCTGCGGCAAGCTGCTTTGGCAATCCCGGTTGCTGTCCAGAGTAAAGATTTTCATGTGGCTTGTGCTAAA
GGGCAGATGCCTCATGGCTGACAATCTACAGAAAAGAGGTGGCCTCATCAGGCGAATTGCTCCCTATGCAACCTGGCATTTCAAGATGACACCCAACCTT
TTTGTTCAATGTGCTTTCACAAACAGGATTTGGAGATTGCTCAGGAGCTAGGTGAATGTTGGCTTTCC