Detailed information on CNT30102528


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006322, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694732Oryza rufipogonOryza sativa91.8669.2499.69959forward
CNT30370776Oryza rufipogonOryza glumipatula55.4668.5297.41579forward
CNT30577075Oryza rufipogonOryza barthii29.7940.2397.43311forward
CNT30117109Oryza rufipogonOryza nivara60.0686.9698.41627forward

Expression of CNT30102528

Peptides detected in this lncRNA

>peptide 1 (30 aa)
LAASPSRSCALAAAAVVLVAAAVFASPPRP*

>peptide 2 (30 aa)
MNVGNARKSYNMKWREYLSFQCFSIYEILL*

>peptide 3 (33 aa)
MMLCNLNCLTFEYTIMHESSRRKEYLFVHHVQTT

>peptide 4 (34 aa)
MVTWGVTAANDSINTMLVLGLIRDTSSVSYYKTF*

Sequence

>CNT30102528
CGCTAGCAGCCAGCCCTAGCCGCTCCTGCGCGCTTGCCGCCGCCGCCGTCGTCCTGGTTGCCGCCGCCGTCTTTGCATCGCCGCCACGACCATAGCCGGA
GACCACAGCCGTGGTCATCCATCACAACCGGTGTTTCCTTTCTTTCTTCCCGAGAGAAGGGTACAGAGAGGTTGTACAGGAGGAAGAAGGAAAGGAAAAG
GCAGAGAAACGTTGAGAAATTTCAGCGATTTCTCAAATTAGAGAAATTTGTCGCAAGGTGTGGAGGGTTCCAACGTTGGAGGAGTTAAGTCGGAGTATCG
AAGGAGTTAAGGTACCTAATGATATTGATCGGCATGGGACGGGAGTAGCACCCTTGGACTACACATTATTATTGCACACTACTGAAATTTAGTTTTAGAC
TATGTTTCTGCCTAGCATAAGTTTTGTGTAGAACTTGTAAAGGTCATTTAAAGTTCCGGTCCATAGTTTCATGGGGAATTCATGGAGCTAGGATGGTTTG
GATTGTGTGGGTTATATCGTTATTGAGTATCTTATAACTGCCTGTCGTGGATGTCCGTATTTTTAGGGGAGACTCTACCGAAATTTCTAATAATTTTGGG
AGTTAGTGGTTTTTAGTGTTTTTGGTGTGGCACTCTAGGTACATGGTTACCTGGGGTGTTACAGCGGCAAATGATTCTATTAATACAATGCTAGTCCTAG
GCCTAATAAGAGATACTTCCTCCGTTTCGTATTATAAGACTTTCTAGCATTGCTCACATTCATATATATGTTAATGAATCTAGGCATATATATGTGTTTA
GATTCATTACCATCTATATGAATGTGGGCAATGCTAGAAAGTCTTATAATATGAAATGGAGGGAGTATCTATCTTTTCAATGTTTTTCCATCTATGAGAT
TCTACTATAAAGAAGACTGCACGAGGGAAAGGCAAAAAATGAATGATGTTATGTAATCTTAATTGTTTGACTTTTGAATACACGATTATGCATGAGAGTA
GTAGAAGGAAAGAATATCTTTTTGTGCATCATGTCCAGACGACC