Detailed information on CNT30102506


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT000139, E-value = 5e-41

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520246Oryza rufipogonSetaria italica31.2121.3891.04201forward
CNT30361377Oryza rufipogonSorghum bicolor31.2117.8590.05201forward
CNT30596646Oryza rufipogonOryza meridionalis100.1687.5297.83645forward
CNT30370630Oryza rufipogonOryza glumipatula51.24100.6197.58330forward
CNT30576982Oryza rufipogonOryza barthii10095.6999.53644forward

Expression of CNT30102506

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MEGVEVEVDVVHHADAAEAMADVLALRPQHRL

>peptide 2 (43 aa)
AIHNSFIRHTKSREYRGKQDELHQISESYGPSSCTYITHCFIS*

>peptide 3 (35 aa)
MAMQCSSPSPESLQMQRSSNPSVRISDFFRGSEGN*

>peptide 4 (49 aa)
MALCIVSGGTYTRGGSSSAGCHPRTTSTARSRCHRGCRRDPCRHGRRRS*

>peptide 5 (88 aa)
EPFIIHSLGIRKVESTGESKMSCIRFLNHMAPPPALTSPTVSSHSNHWLAKGHTLTQTRGRTDTIDCHTPIDRTNEHGLISVADRSNY*

Sequence

>CNT30102506
GAGCCATTCATAATTCATTCATTAGGCATACGAAAAGTAGAGAGTACAGGGGAAAGCAAGATGAGTTGCATCAGATTTCTGAATCATATGGCCCCTCCTC
CTGCACTTACATCACCCACTGTTTCATCTCATAGCAATCATTGGCTCGCAAAAGGACACACACTGACACAAACTCGAGGACGGACGGACACCATTGACTG
CCATACTCCGATCGATCGAACGAACGAACACGGTCTTATTTCGGTAGCAGATCGATCAAATTATTAGCTAGAGTAGAAGCAGAGCAGACGCGACGACGAT
GGCAATGCAATGCAGCTCCCCCTCCCCGGAATCTCTGCAGATGCAAAGAAGCAGCAATCCAAGTGTCAGAATCTCTGATTTCTTCAGAGGATCCGAAGGA
AATTAATCGATCAGCGATGGCATTGTGCATTGTTAGCGGTGGAACTTACACCAGGGGAGGATCTTCCAGCGCTGGTTGTCACCCTCGCACCACTTCCACA
GCACGATCTCGGTGCCATCGTGGATGCCGCCGTGATCCTTGTCGCCATGGAAGGCGTCGAAGTTGAGGTAGATGTTGTTCACCATGCGGACGCAGCGGAA
GCCATGGCCGACGTCCTTGCTCTCCGTCCACAGCACCGACTCGT