Detailed information on CNT30102355


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673696Oryza rufipogonSetaria viridis38.1841.3287.17226forward
CNT30521727Oryza rufipogonSetaria italica37.3334.7590.05221forward
CNT30669606Oryza rufipogonTriticum dicoccoides22.4724.493.23133forward
CNT30142107Oryza rufipogonLolium perenne28.8919.9183.63171forward
CNT308481Oryza rufipogonZea mays39.8640.6984.75236forward
CNT30344603Oryza rufipogonEragrostis tef25.8430.4892.81153forward
CNT30364335Oryza rufipogonSorghum bicolor27.218.4689.44161forward
CNT30580110Oryza rufipogonEchinochloa crusgalli37.3332.9989.59221forward
CNT30497096Oryza rufipogonDigitaria exilis2538.3488.51148forward
CNT30116039Oryza rufipogonOryza nivara58.7859.6999.14348forward

Expression of CNT30102355

Peptides detected in this lncRNA

>peptide 1 (78 aa)
SINITKSTYHTRSSLTKTSLISCLIQKLRWTDSQESTLYLSFTLQGQPAAACRPTTACARARNNQPITHSTHAHKNHP*

>peptide 2 (34 aa)
MDGFTREHPLLKLYITRPTSSCLPADHCVRTRAQ*

>peptide 3 (40 aa)
MVLGMMMSPMLLCHGSERWAGRGWPGIHSADMVTRPEVVA*

Sequence

>CNT30102355
CATCAATCAATATCACCAAATCGACGTACCATACCAGATCGAGTTTAACTAAGACCAGTTTGATTTCGTGTTTGATACAAAAATTAAGATGGACGGATTC
ACAAGAGAGCACCCTCTACTTAAGCTTTACATTACAAGGCCAACCAGCAGCTGCCTGCCGGCCGACCACTGCGTGCGCACGCGCGCGCAATAATCAACCA
ATCACACACAGTACGCACGCACATAAAAACCACCCATAGCCTTCACGTACGCCCGGACGCACGCACCGGTTCGTGCCAAGCTCAAGGGTAGATGGTTCTC
GGGATGATGATGTCGCCGATGTTGTTGTGCCACGGGTCCGAGAGGTGGGCGGGGCGTGGCTGGCCCGGCATCCACTCGGCGGACATGGTGACGCGCCCGG
AGGTGGTGGCGTAGGCGCAGACCGGCAGGCGGCTCCTGTTCGACGACGGCGCCAGCAGGCTCGGCACGCCCACCGCGCTGCAGCTCCTCAGCCCGCTCGT
CGCCATTGCCGCCGCCGCCGCTAGCTTCTCCTCCTCCTCCTCCTCCTCGAACACACCAGCAAGAAGACGAAGTAGGAAGAAGAGGTGGCCGG