Detailed information on CNT30102332


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007325, E-value = 5e-120

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694051Oryza rufipogonOryza sativa25.0217.9698.5399forward
CNT30117052Oryza rufipogonOryza nivara63.1396.7398.411007forward

Expression of CNT30102332

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MRSQEGLVIRVYLLCLQKPESVSCVNPAQNRTILLPLDSGHM*

>peptide 2 (36 aa)
MDLPQALIPLVIKPAPKSTSVAKRGRKRHRRSKMIAT

>peptide 3 (48 aa)
PFLAPSARLLSARLAPPPSACRASLPTDQPSTRAAAPHHQTAPPSKIA*

>peptide 4 (43 aa)
MSLPGHKPRAARCEAPPSRLYHGPPASSDTTCYKTSPEIDIGS*

>peptide 5 (66 aa)
MDDAAPTQERTPPLPPVSAASSKSRHRRASAACTCCSPKPCSAAGARHRRPPLPTKSNRSDLALLW*

>peptide 6 (52 aa)
MSITQLPHQHLQKLPLGTTCSDFRLNTINLVASRSRQVACRLLSREQPECYV*

>peptide 7 (78 aa)
MLRLPIKHHQSSREPKPTSCMPSSQPRTTRVLRLAVSLSNATHRKAQATPPRVIDPPTENADRLQLQSTRACGRTSPY*

>peptide 8 (73 aa)
RFLLLLPDSSRPDWRRRPAPAVPLSPLTSQAPEPPHPTTKPRRRRKSPRFPPPMPVLECLPAGPAVDASEDPR*

Sequence

>CNT30102332
CCCGTTTCTTGCTCCTTCTGCCCGACTCCTCTCGGCCCGATTGGCGCCGCCGCCCAGCGCCTGCCGTGCCTCTCTCCCCACTGACCAGCCAAGCACCAGA
GCCGCCGCACCCCACCACCAAACCGCGCCGCCGTCGAAAATCGCCTAGGTTCCCGCCGCCGATGCCCGTCCTCGAGTGCTTGCCTGCAGGTCCTGCTGTC
GACGCCTCTGAAGACCCTCGGTGATGGACGACGCTGCCCCGACGCAGGAGAGGACGCCTCCTCTGCCGCCGGTGTCCGCCGCCTCCTCCAAGAGCCGGCA
CCGCCGAGCTTCCGCCGCCTGCACCTGCTGCTCGCCGAAGCCGTGCAGCGCCGCCGGAGCCCGACACCGCAGACCACCTCTGCCCACGAAATCCAACAGG
TCAGATCTCGCCTTGCTTTGGTAGTTTGCCCGATTGCTTGTTGTTGCAATCCCGTGGTCCTCTGCTGCTTTTATTTGGAGAAATTCGAGTCCAATTCTTA
ACCAAATCGAAGAAACTCTTTGTTCCCCTTCCGTGTACGAGTTGGTCACCGGTTTGGCTTTTTCCATGCGTAGCCAGGAAGGACTCGTAATCCGAGTCTA
TCTGCTGTGCCTGCAAAAACCCGAGTCGGTCTCCTGCGTAAATCCGGCCCAAAACAGAACCATCTTGCTACCTCTGGACTCCGGTCACATGTAGTCTACG
GCTTCGACATGCAAACGTGCACACCGCCACCTCTGATGACCTCCTCAGCCACCACGCACCCGTACGACCTCTAGCGCAACCAACCGACATCCCGCCCAAC
CTCGCCAGCGACCAATATCGCCGGTCAGTTGCAACCAATGCCTTTGCTGTACTAACACAATTGAATAAAGCATTGACGATCTGAATTGACCACCCCTCTG
CCTGATTCCATCGCTTGTCGTATGTACGCCTTCTCTATAGCATGTCCATCACGCAATTACCTCATCAACACCTTCAAAAGCTGCCTCTAGGAACCACATG
CTCCGACTTCCGATTAAACACCATCAATCTAGTCGCGAGCCGAAGCCGACAAGTTGCATGCCGTCTTCTCAGCCGCGAACAACCCGAGTGCTACGTCTAG
CCGTCTCCCTGTCGAACGCAACTCATCGAAAGGCCCAGGCCACCCCGCCCAGAGTGATCGATCCACCGACCGAGAACGCCGATCGCCTCCAGCTTCAATC
AACCCGAGCGTGCGGCCGCACTTCTCCCTATTGAGAGTAGCTCACCGGAAAGTCCGAGCCACCCGCTCGAAGTGTCCGACCCACCGATTGGATCACCAAT
CGCTTTCTGCCGCCATCAACCTGTTGAAAGCAGCCATCGAACGGTTCAGACCGCCGCCTGAAGTGTTCGATCCACCGATCAAATTCCGTTGATCGCCGCC
GTGCTCCACCTTGCGCACATGTCCCTCCCTGGACATAAACCGCGAGCGGCGCGGTGTGAAGCACCTCCATCGCGCCTCTACCATGGACCTCCCGCAAGCT
CTGATACCACTTGTTATAAAACCAGCCCCGAAATCGACATCGGTAGCTAAACGCGGAAGAAAACGCCATAGGAGATCCAAAATGATAGCGACACC