Detailed information on CNT30102281


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696163Oryza rufipogonOryza sativa49.6446.0797.75757reverse complement
CNT30116954Oryza rufipogonOryza nivara39.0296.1299.66595forward

Expression of CNT30102281

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MLLSAPSMPRLPTRPALLILLLELSNPQLKEVDSHG*

>peptide 2 (70 aa)
MVVLYVTIFRLIGYKSWEWLAIEVKVERGCVARCVHWLKVIVVPLSISPTSTFSYLLPGGVRNAAHTSPC*

Sequence

>CNT30102281
CTGAATCCTCGTAGTTCAAATCGAAACTAGCTGGCACTCCCCACTGACCCGACTCCGCCCCTAGTTCCCTTCCAGCATTCCATCAAACGCGTCAAGATTT
AATTAAACTATACGAATATAAATACAATAATTTACAATTACAAATGTGCTTACAAATTTGTAACCTTTTTATTATACCAAAACTCCAATTGCGATGTGCT
AGATAATTTATCTAAAGTATACTTGGACTGCAGATTATTGGGTCCCTATGCTCAAGTTGGTGTTCTGTGTAGCCTACTAATGTGCATCTAGCAATTAGTC
CACCTTTCCTTTTCTCCTCTGTTCTCACCTGTACAGACCTCTCCCCTTCTCTCCCCTTTTATGACTCGTACAGGTAAAAGCATCAGCTAGCTAATCCCCT
TCTTCCTTCCTGCATTTGCTGCTAGCAGTGGCTATCTTCTCCCTCAAATCCCCACTCTAGTACTGTTGCTGCTGCCACCATGTTGCTCTCGGCGCCCTCA
ATGCCCAGGCTACCAACAAGACCTGCCCTCCTAATCCTCCTCCTTGAGCTCTCCAACCCACAGCTCAAAGAAGTGGACTCCCATGGCTAGAATGGAGTCA
CGCATGGAACTCTAAGCCCAGATGCCCTGACCAGTGCCCCATAGTGCTCGACATCACCGTGCAACCATCCCCTAGGTCCAGTTCTTCCCCAAACCGGCAG
TCCTCCTTCCTACCGAGCTGATGGTGGTGCTCTACGTCACCATTTTCAGGTTGATTGGCTACAAATCTTGGGAATGGTTGGCAATTGAGGTGAAGGTGGA
GAGGGGTTGTGTTGCTCGATGTGTTCACTGGTTGAAGGTGATTGTTGTGCCCTTATCTATCTCACCTACTTCCACCTTCTCTTACTTATTACCAGGAGGT
GTTAGGAATGCTGCCCATACTTCTCCCTGTTGATTTTCACTATTATTATGGGTATGTGTCACAAGCTCACTAGGTGAGAGTTTTTATTTACTCTTTGCAC
TGTGGTCACCTTGACCACCCTTGACTGGATAAAGAAAATATGGCTTCTTTTATGGTGGTACCAATTGTGGCCGCAAGGGTGAAAGACGAGTTAGTGGCTC
GTTCGTTAGTTGAATGATGATAATCAAGACTAGCTTAAAGTGTTGATCTATCCTTGATGGCATTGATACCTCTCTGAGTTAGCAGATGAAAGTTGCAGTT
TATGGGTGTGACAGCTAATTTGTAGCTAGTATGAACCTCTTATATGCTTATGTATTCAGACCATCTACATTTCTAATTATTTAATCGAATGCACTTCTAG
ACATGTATTGAAATGCTTTGGGGTTCGCTAACCAATATATGTGGGATTCTGATTCAATGCATGGGAAACTAAGTTGAGTGCCTACATGTGCACTGCTTGG
TTCCTTTTAAAACTATAATTATGTGCATAACAACAGATTTATGATTTAACTAAACTGCGGGTTGTTTCATAAGTCCCAACATCTGGTGAGTTTCCCCGAA
CCAGCATTTCATCTAGGGGTGAAAA