Detailed information on CNT30102264


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694484Oryza rufipogonOryza sativa79.09100100541forward
CNT30673601Oryza rufipogonSetaria viridis9.523.0592.3165forward
CNT30398657Oryza rufipogonTriticum turgidum8.0422.1892.7355forward
CNT30554101Oryza rufipogonOryza glaberrima81.5887.1999.1558forward
CNT30140884Oryza rufipogonLolium perenne14.1827.1790.7297forward
CNT30368472Oryza rufipogonSorghum bicolor14.1822.7291.7597forward
CNT30370564Oryza rufipogonOryza glumipatula70.7610097.93484forward
CNT30576633Oryza rufipogonOryza barthii73.68100.699.01504forward
CNT30117076Oryza rufipogonOryza nivara76.17103.1796.16521forward

Expression of CNT30102264

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MLADDNGKSNLGTSGSLTVETRHWLHHNTHQWRQQGALSVIGREKK*

>peptide 2 (41 aa)
MSHLKIHLSNYLFVLLSTHETLAYLYTSLKLTIVLYLPMRH*

>peptide 3 (48 aa)
MMMMDRLTRHRLHPAIPKTIFNFISFRFENVTLENTSFKLPICSSVYP*

Sequence

>CNT30102264
GACGGAATTAGAAACAATTTAATCTAACATACGCAAACTGATATTATCACAATGTTAGCCGATGACAATGGAAAGAGTAATCTAGGTACAAGCGGATCAT
TGACGGTGGAGACAAGACATTGGCTGCACCACAACACCCACCAGTGGCGCCAACAAGGAGCGCTATCCGTTATAGGACGAGAGAAAAAGTAAAACATCAC
GATGTGAAGTGAAACTGAATAATTCTAGTAGACGATGATGATGATGGATAGGCTCACTCGTCATCGTCTTCATCCTGCAATCCCCAAAACCATTTTTAAT
TTCATCAGTTTCCGTTTTGAGAATGTCACACTTGAAAATACATCTTTCAAACTACCTATTTGTTCTTCTGTCTACCCATGAGACATTAGCCTATTTGTAT
ACATCTCTCAAACTAACTATTGTTCTATATCTACCCATGAGGCATTAGCCTAATCAAAGTGTGAATCGTACTCCTAATCGTACAAGCCTCAGGCATAGTC
AGCTAAGCTTCACACAACGAACTAATGCGATACTATTTTCTGAATTGATCACAAGGATTATGTATGTAGTACCTCTTCGCTGCCCTCGTCGTCATCCTCA
TCATTGACCTCGGACTTGGACTTGTCAGATTCCTCCTCGTCGTCCTCCTCTTCCTCCTTGGCGGGTGCCTTCTTGGCAGTGCTC