Detailed information on CNT30102228


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001330, E-value = 8e-07

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30302628Oryza rufipogonTriticum aestivum2.0927.3983.7286forward
CNT30553992Oryza rufipogonOryza glaberrima22.7910099.68937reverse complement
CNT30667599Oryza rufipogonTriticum dicoccoides2.0928.8683.7286forward
CNT3067041Oryza rufipogonLeersia perrieri7.7820.2782.5320forward
CNT30105326Oryza rufipogonOryza longistaminata84.1278.3697.693459reverse complement
CNT30576862Oryza rufipogonOryza barthii32.3260.7198.421329reverse complement
CNT30116895Oryza rufipogonOryza nivara83.9786.4399.573453reverse complement

Expression of CNT30102228

Peptides detected in this lncRNA

>peptide 1 (39 aa)
GLHRRSLIISLSVRPPRAAAPATASTRPRRSVRPARGGR*

>peptide 2 (38 aa)
MPVALSLDGHSFRMITRVAPLPLELIGLVIRDGGGWVI*

>peptide 3 (95 aa)
MPLNSHLHVALILSSGERQKISPLVLIFEFVNLFYFLYSTEFAQTRCIILFSWLDLEQKGFTHWRYQPFEFSILISNGCIEHCHMPVLISLPTKK*

>peptide 4 (80 aa)
MRRPRPLARTRLPERRPRASEPSAFAGPSLPPSAPPRGASALGDRGPWGRWGGDAAASGKGRAGRPSCLLTTRNWRLCHC*

>peptide 5 (78 aa)
MQLCSSSICILRIGYSSFFFSCTSAMPVLCNGIWSNTDEWFYGVQFYLSGETPRGLPANSTRWWARRPGFEASPLIII*

>peptide 6 (76 aa)
MTAPPDRDRGHLGNTGGDEEAPALGADASPRAAAARVGTLRLRGAIPPPVRAATGRIGVGGSGTVGAVGRRCRGFR*

>peptide 7 (64 aa)
MQIGGTNHLNPHNNYHGIKCFEHCHMSVLISLLRQVTNKATILYIHSSKEQNKPSFYVLFIFGLY

>peptide 8 (48 aa)
MLGGLAPQQVTSCSYFLSVHAIMNDSTHLFMYTGMEGVVTCCQNQGHL*

>peptide 9 (41 aa)
MLTVYSVSFSVIFLFVVSYFHSILLWMHISLFVIFLFLEWL*

>peptide 10 (34 aa)
MGFSSIYPEKRLGVFRLTPQGGGLDDLGSKPHPL*

>peptide 11 (35 aa)
MAVMILLPIGDHSASSWFLGNMFKANFATGHAYVN*

>peptide 12 (33 aa)
MILLIILFMYKVDGGSTYMLPEPRAFRTVGIAI*

>peptide 13 (33 aa)
MPLLKGVSQEFLPTACRRSIRREAAASGFPSLR*

>peptide 14 (29 aa)
MYATEFALARCLDLIQWRKAKNLPSCFDI*

>peptide 15 (31 aa)
MPMSISCDTRRPCSPASYQLQLFLLSTCYNE*

Sequence

>CNT30102228
GCGGACTCCACCGCCGCTCACTCATCATTAGTTTAAGTGTGAGGCCACCGCGAGCGGCGGCGCCGGCGACGGCGAGTACTCGACCTCGCCGCTCCGTCCG
TCCTGCTCGCGGCGGCCGATGACCGCACCACCCGATCGAGACCGCGGCCATCTCGGGAACACCGGCGGCGATGAGGAGGCCCCGGCCCTTGGCGCGGACG
CGTCTCCCCGAGCGGCGGCCGCGCGCGTCGGAACCCTCCGCCTTCGCGGGGCCATCCCTCCCCCCGTCCGCGCCGCCACGGGGCGCATCGGCGTTGGGGG
ATCGGGGACCGTGGGGGCGGTGGGGAGGCGATGCCGCGGCTTCCGGTAAGGGGAGGGCGGGTCGGCCAAGTTGCTTGCTGACGACGAGAAATTGGAGATT
ATGCCATTGTTAAAAGGGGTTTCGCAGGAATTCCTTCCCACAGCTTGCCGACGATCAATCCGCCGAGAGGCCGCAGCGTCCGGATTCCCATCTCTAAGGT
GAGCCGCCGCCGTGCAGTGAAGGCAATTGGAACCTAGGGTGGTGTCCGGATCGGCTGTGGACTCTTGGGGGTTTTGGTCGTCGTCGTGAGCTTGAGCCGA
CTTGGCTCGTTAGAGCAGGTACAATTGGAGGAGAGAGAGAGAGAGAAGAAGAAGAAGAAGAAAATCAGGCTGTAGATCTGGCTATACTATTATACTTGCT
CTTAGTGTTGGTGATCGCATCAGCATATGCTGTATTTGTGGCAGGGTACTACGTATGGTCCGCAATGAACACAGAGGGCGATGACGATCGACCTTGGCTG
AAATAAGCATGCCTTCAAGCAATTGAGGCTGCTGTGGGTATTAAATTGGACCCTCCCTCTACCCCCTTTGAGCCTTTCTAGTCATGTGCTAATGCCAGTG
GCTTTGTCCTTGGATGGTCATTCGTTTCGAATGATAACCAGGGTAGCTCCACTACCGCTAGAACTGATAGGTCTGGTGATAAGGGATGGTGGGGGTTGGG
TTATTTGATTGATCAAAGGCGAAGCTGAGCCCAATGAAGGTGCTCGATGCAGTTGTGTTCCTCAAGCATTTGTATTCTTCGCATTGGCTACAGTTCCTTT
TTCTTTTCATGCACTAGTGCTATGCCCGTGCTTTGCAACGGGATTTGGAGTAATACGGACGAATGGTTTTATGGGGTTCAGTTCTATCTATCCGGAGAAA
CGCCTAGGGGTCTTCCGGCTAACTCCACAAGGTGGTGGGCTAGACGACCTGGGTTCGAAGCCTCACCCCTTATAATTATTTGATATTAGGTCCTTCCCTA
ATATTTCCGTTTTGTTCTATCTGGTCTTCTTGGTGATTGATTTTCACATGGAAAGGGTCATTCCATTCTGCATATACCTACTAAATGTCAGCAAATGCAA
CATTGATATCTGAAGCAGTGGCATAGTATTTCACTTTATTACCACCTCGTTTTGCGTGAAACACTTAATCTTTATCTTTGGCCCTGTTTAGTTCCAAAGT
TTTTTTTCCAAACTTCCAACTTACCATCACATCAAACCTTTTATACACACAACTTTTCAGTCACATCGTTCCAATTTAAACCAAACTTTCAAACTTCAGT
GTGAACTAAACACAGCCTTCATCTTCAGGAGATTCAAACACCACCTTAAATGTCAGAAAATGCCATGTTGTTATTTTTAATTTCTTGAATGGCTGTGATG
ATTTTGCTGCCCATTGGAGATCATTCGGCATCTTCTTGGTTCCTTGGTAATATGTTCAAGGCAAATTTTGCTACAGGACATGCCTATGTCAATTAGCTGT
GATACTAGGAGGCCTTGCTCCCCAGCAAGTTACCAGTTGCAGCTATTTCTTCTCAGTACATGCTATAACGAATGATTCTACTCATCATTTTGTTCATGTA
CAAAGTGGACGGAGGGAGTACTTACATGTTGCCGGAACCACGGGCATTCAGAACTGTTGGAATTGCCATTTAGGTTAATCTGAGCCATTCAAATATATTT
CTTTTCTTTTCAATCATTATTTTACCCAAAAGCAGTCTTTAGTTTTCCTGGTTGTACTTGTATGGATCCGAGTTGTCTGGATTCATAAATCTCATTTTGC
CTTTCATGTATGCCACTGAATTCGCACTTGCACGTTGCCTTGATCTTATCCAGTGGCGAAAGGCAAAAAATCTCCCCTCTTGTTTTGATATTTGAGTTTG
TAAATTTATTTTATTTTCTGTATTCCACGGAATTTGCACAAACGCGTTGCATCATTTTGTTTTCCTGGCTAGATTTAGAGCAGAAAGGATTCACCCATTG
GAGGTACCAACCGTTTGAATTCTCAATACTAATTTCCAATGGGTGCATTGAGCATTGTCACATGCCTGTGCTGATATCCCTACCGACCAAAAAATAGTCG
TCTTTGTGTATTATTTATCTTCAGTCTTTATCAGCACTTCAGCGCAACTTATTTCCTTTTGTTTTATTCGTGTTATCTTCTCCCACAACCGACATTTTAC
AGTGCTCTGGCAAATTAGCAAGCATGTCTCGCGATGGCAGTTTGCTACTTTTTACCCATTGCAATATCCTGTTGGTAATCAGCTCAATGGTATTTTAGTT
CTTACTTTTTTACCAGCAGGCACTTTAATGAGCACGAAGTCTTCCCAGAATGAATAAATCATAAATGGGGGGATGTTATGGTACCATCATGGGCAATACT
TGTAGTCTAACTTGCTTACTGCACGGTGATGACAATACTTGCTCATAGGAGCTTAATTGTTTCTTTTTTCTAAAATTAAGTAATGTAACACTAATAAAGG
AATGTTAACTGTTTATTCAGTTAGCTTTAGCGTGATCTTTCTTTTTGTTGTTTCATACTTTCACAGCATACTTCTGTGGATGCATATTTCATTGTTTGTT
ATTTTTTTATTTCTTGAATGGCTATGATGATTTGGCTGCCCATTGGAGATCATTTGGCATCTTCTCGGTTCCTTGGTAATATGTTCAATTAGCTGTCATG
CTAGGAGGCCTTGCTCCCCAGCAAGTTACCAGTTGCAGCTATTTCTTGTCAGTACATGCTATAATGAATGATTCTACTCATTTGTTCATGTACACTGGGA
TGGAGGGAGTAGTTACATGTTGCCAGAACCAAGGGCATTTGTAACTGTTTGGAATTGACAGTTGTTAATCTGAGCCATTCAAGTACATTTCCTTTGTTTT
CAACCATGTTTTACTCAAAACAGTCCTTAGTTTCTTACGGTTGTAACCACACAGGCATTTGGAACTGGTGGCTGTGATGATTTGACTGCCCCTTGGAGAT
CATTTGGCATCTCCTTGGTTCCTTGGTAATATGTTCAATCGGCTGTCATACTAGGAGGCCTTGCTCCCCAGCAAGTTACCGGTTGCAGCTATTTCTTGTT
AGTACATGTTAAATGATTCTACTCATTTGTTCATGTACTGAGGGACGGAGGTAGTATGTACATGTTGCCAGAACCGTGGGCATTTGTAACTGTTGGGAAT
TGACAGTTTGGGTTAACCTGAGCCATTCTAGTACATTTTCTTTGTTTTCAACCATGTTTTGCCCAAAACAGTCCTTAGTTTCTTATGGTTGTATTGTATC
TGTATAGATCCATGTCTGGTATTTTTCTGTTTGCTGAGAAGCTAATAATTGTATAGAACTGATTTTTTCGGATTCATAAAACACATTTTTACTTTCATTT
ATGCCACTGAATTTGCACTTACATGTTGCGCTGACCCAATCAAGTGGCATGTATGAGATGATGTAACAAGTCCGTGGCGAAAGGCAAAAATCTCCCCTCT
TATTTTGATAGTTTGCAAGTTTTAGTTTCTTTTATTCTCTGTATTTGTATTGACGCTTATTATACATACACATCGCATTGTTTTGTTTTCCTGGCAGACT
TCGAACAGAAAGGATTCATGCAAATTGGAGGTACCAACCATCTGAATCCTCATAATAATTATCACGGGATAAAATGCTTTGAGCATTGTCACATGTCTGT
GCTGATTTCCCTACTTAGACAGGTTACAAACAAGGCCACCATCTTGTATATACATAGTTCCAAAGAACAAAATAAGCCTTCCTTTTATGTATTATTTATC
TTCGGCCTTTAC