Detailed information on CNT30102178


BLAST search results

BLAST vs Swiss-Prot:
sp|P14947|MPAL2_LOLPR, E-value = 3e-18

BLAST vs NONCODE:
NONORUT005905, E-value = 5e-168

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3067584Oryza rufipogonLeersia perrieri31.6632.1981.42253forward
CNT30370385Oryza rufipogonOryza glumipatula58.790.8989.77469forward
CNT30107148Oryza rufipogonOryza longistaminata53.0784.9796.93424forward
CNT30576665Oryza rufipogonOryza barthii48.5671.9996.39388forward
CNT30116883Oryza rufipogonOryza nivara50.4495.0598.51403forward

Expression of CNT30102178

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MATLVTSSRLFPLEPSPTLKATSVAHEPTTNNAATATASQKEYNEAIGELASLLVLSFLFLERDGSMCLVIHVAA

Sequence

>CNT30102178
GTCATACGAAAGAAGATAAACGAGCTTCATTGATATGGAAATACATATACATATGTACTCAAACTTTAGAAAAATAAAATGTAAGAAACTATCTAGATGA
AGGTTCACCAACTATACTTTTTCCCACAAATATTATATACGTAATATACTCAAAATCGTCTGGATATATACCTCTGCAGCAACATGCAGACATGGCATAC
GGAATGCTTTATTTTGTTGATGACATATTTCACAAAATAACCAAAGAAAATTAATTATTGGCTTCCCCAAATGCAGACTTGATCTCTCTTTTGAAAAAAA
AGGAATCATAGAGAGGTTAAGAATTATTTCAAAAAAAAAAAGCACACATGTCTATCACTTAGATGTTGATGCCACTCTTATATTCAGAGCCAGCCGTAAA
GCTTTCGGGGATGACGTCATCGACGACACGGTAGCCGCCGTTCTTGACAAGGAAGCGGACGGAGAAGGGGCCCTTGAGTGCCGCCTCACTCTTGAGCGAC
CAGGTGTTAGTCGACGACTCCTTGAGCGCCACCCAGTCCTTGCCGCCCTTCTCCTTGATCTCCACCTCAGAGATGGCGACGTTGGTGACGAGCTCTAGAC
TTTTTCCGCTAGAGCCCTCACCGACCTTGAAGGCGACCTCAGTGGCGCATGAGCCAACGACCAACAATGCCGCCACTGCCACGGCGAGCCAGAAGGAGTA
CAACGAGGCCATTGGCGAGCTAGCTAGTTTGTTGGTGTTGTCTTTCTTGTTTCTTGAAAGGGATGGATCGATGTGTTTGGTGATCCATGTTGCAGCTGG