Detailed information on CNT30102154


BLAST search results

BLAST vs Swiss-Prot:
sp|C0LGP4|Y3475_ARATH, E-value = 6e-32

BLAST vs NONCODE:
NONORUT005534, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696849Oryza rufipogonOryza sativa11.8432.4885.15101forward
CNT30524460Oryza rufipogonSetaria italica16.0634.1681.02137forward
CNT30193077Oryza rufipogonSecale cereale29.6644.1579.84253forward
CNT30553978Oryza rufipogonOryza glaberrima51.4736.3497.04439forward
CNT30370431Oryza rufipogonOryza glumipatula32.5926.0195.32278forward
CNT30110144Oryza rufipogonOryza longistaminata15.9429.69100136forward
CNT30576775Oryza rufipogonOryza barthii74.2192.8297.31633forward
CNT30117041Oryza rufipogonOryza nivara32.7147.0594.98279forward
CNT30604193Oryza rufipogonOryza punctata23.0930.8393.91197forward

Expression of CNT30102154

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MCSISLSSCDVEPFEAHDTQYQSFSWHVPDGCV*

>peptide 2 (48 aa)
MACSRWLCITFMATTKPLLNWPLKTFPKLPDPNILSSLKLSVARTSSW*

>peptide 3 (69 aa)
QDRLVWYHLSHWFDRPARSSTRRRRRFSSSRRRGLPSYPSLRRRSHLLVLRATAGASSAESISTSSPIR*

>peptide 4 (66 aa)
MSSHSKHTTLSIKASHGMFQMVVYNFYGNHQTATQLALKNFSEASRSQHIVFTEIIGSANKLMVGE*

>peptide 5 (59 aa)
SGSVSLVSSEPLVRPAGEEFHAPPPPLLLQPPAGPPFLPKPPPPFPSPRPPCHRRRLFR*

Sequence

>CNT30102154
TCAGGATCGGTTAGTTTGGTATCATCTGAGCCATTGGTTCGACCGGCCGGCGAGGAGTTCCACGCGCCGCCGCCGCCGCTTCTCCTCCAGCCGCCGGCGG
GGCCTCCCTTCCTACCCAAGCCTCCGCCGCCGTTCCCATCTCCTCGTCCTCCGTGCCACCGCCGGCGCCTCTTCCGCTGAATCCATCTCCACCTCCTCAC
CTATTCGCTAACGCCGCCTCCCATCCTCTCTTCTCTCCGGGCTCCGGCTAGATCCAAGTCGGCGTCGAGATCCAGGGCTCGAAAACCCCTCACCTATCCA
AGGATTTCAGAGATCGTAGAGTTATCATCGCCTAGTAACAACCTCGCAATGCCAAAGTCTGCCACATGTGCCGTCATTTCATCATCGAATAGCACATTAC
TAGGCTTCAAATCACAGTGTACGACCACCTCATAGTGCTCATGGTGCAGGAGTGCTTCTAAGCTACCCTGAGGCATGTACTGAAGAACCAATGCTCTGAA
CTCCAGGTTGGAGCATGTGTTCAATATCTTTATCAAGTTGCGATGTCGAGCCATTCGAAGCACACGACACTCAGTATCAAAGCTTCTCATGGCATGTTCC
AGATGGTTGTGTATAACTTTTATGGCAACCACCAAACCGCTACTCAACTGGCCCTTAAAAACTTTTCCGAAGCTTCCAGATCCCAACATATTGTCTTCAC
TGAAATTATCGGTAGCGCGAACAAGCTCATGGTAGGAGAGTAATTGGTGGCTGATCATGTCAAGCATACCAGAAGAAATATTTTGATGCTTAACTTTCTT
TCTAATTATTCCATATAGGCAACAAGTTACCGCTGCAACTACTATGATTATAC