Detailed information on CNT30102137


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005670, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554971Oryza rufipogonOryza glaberrima40.2594.5898.46454forward
CNT30369595Oryza rufipogonOryza glumipatula63.2188.5796.07713reverse complement

Expression of CNT30102137

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MYAGEWSSSFVSEPGILEHLVTKVLLAPA*

>peptide 2 (37 aa)
MPSRIDQHFKLVLIIIIQLTNEPLTRLSPLRPQLVPP*

>peptide 3 (45 aa)
MPLGVLKIKGMLFMTMTCIMEDGMSRCMQGSGLVALLVNLEYWST*

Sequence

>CNT30102137
CGATTAAATAATTAGAAATGTAGATGGTCTGAATACATAAGCATATAAGAGGTTCATACTAGCTACAAATTAGCTGTCACACCCATAAACTGCAACTTTC
ATCTGCTAACTCAGAGAGGTATCAATGCCATCAAGGATAGATCAACACTTTAAGCTAGTCTTGATTATCATCATTCAACTAACGAACGAGCCACTAACTC
GTCTTTCACCCTTGCGGCCACAATTGGTACCACCATAAAAGAAGCCATATTTTCTTTATCCAGTCAAGGGTGGTCAAGGTGACCACAGTGCAAAGAGTAA
ATAAAAACTCTCACCTAGTGAGCTTGTGACACATACCCATAATAATAGTGAAAATCAACAGGGAGAAGTATGGGCAGCATTCCTAACACCTCCTGGTAAT
AAGTAAGAGAAGGTGGAAGTAGGTGAGATAGATAAGGGCACAACAATCACCTTCAACCAGTGAACACATCGAGCAACACAACCCCTCTCCACCTTCACCT
CAATTGCCAACCATTCCCAAGATTTGTAGCCAATCAACCTGAAAATGGTGACGTAGAGCACCACCATCAGCTCGGTAGGAAGGAGGACTGCCGGTTTGGG
GAAGAACTGGACCTGCAGGGGGAGGAGTGAAGCTCATTAGCTGCAAACTTGTGGGGGATCAATCAAGAAAACATCACCCACCAACAGAAAGGGAGCAGAT
GCAAACATTTCTGGGCAAGCCAGTGAGTTAAGTGGTGGGTTGGAGGATCAGTACTATGCCCCTTGGTGTGCTGAAAATCAAGGGGATGTTGTTTATGACT
ATGACATGTATTATGGAGGATGGGATGAGTAGATGTATGCAGGGGAGTGGTCTAGTAGCTTTGTTAGTGAACCTGGAATATTGGAGCACCTAGTGACCAA
AGTATTGCTAGCTCCTGCTTGAAACTTGTATTATTAATGGGTGAACGTGTAAGGCCCTGTTTCAGACTTTAGCCCTGCGTGGCATGGTATTGTAATGTTA
TCTGAACCTTCTAGCTATTATTCTGCTGCTATCTCTGATGTGGATCATTATTCGCTAGAGTGCGGCTATGGCAAATAATAATCCATGGACTAGTGACGTC
ATTTCGGTAATGACGGCGTGGGTCGTCA