Detailed information on CNT30102087


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30102087

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MSTTWDYYAPTHRSIDLMQDYKRRRGGGGRRRAAIRRTGRRRSRSRACRRMGRRRGRRRRRRR*

>peptide 2 (59 aa)
MSFASTLRLSAPCCCRCWWWWCSAAALSSTASASAPAAATPNSMASAATAAAAAEPMGAT

>peptide 3 (38 aa)
ELTKQVIHPANKPMHKLKQIKAIKHALFCFHQQFLADE*

>peptide 4 (38 aa)
MGLLRPYTSIDRFDARLQATARRRWPAAGGDQKDGTTP*

Sequence

>CNT30102087
GAACTAACAAAGCAAGTGATTCATCCTGCTAATAAGCCCATGCATAAACTTAAACAGATCAAAGCCATCAAACATGCCTTATTTTGTTTCCATCAACAAT
TCCTAGCTGATGAATAATACCATATAGTTGTGATTTATTCGTTGGGGGGAGCTAATACAATATAGATGATCTTGCTGATCAAAAAAATAATTACCACTAA
GTAGTAAGCACGTAATTAGTAGCAGTAGTAGTGTACAAAACTAGCGTGAGCTAGCTCAAAATGAGTACTACATGGGATTACTACGCCCCTACACATCGAT
CGATCGATTTGATGCAAGATTACAAGCGACGGCGCGGCGGCGGTGGCCGGCGGCGGGCGGCGATCAGAAGGACGGGACGACGCCGTAGCCGAAGTCGAGC
ATGTAGGAGGATGGGACGGCGGCGGGGTCGTCGGCGTCGGCGCCGCAGGTGAAGTCGAGCTCTATGGCGGCGCCGGCGCCGGCGCCGTTGGGGACGACGC
TGTCGGCGTGGGGGAAGCGGGCGAACTCGACGTTGAGGTAAGGGTCGAGGTCGGAGAAGAGGTAGTCGAGCTTCATGTCCTTCGCCTCCACGTTGAGGTT
GAGCGCGCCGTGCTGCTGCCGCTGCTGGTGGTGGTGGTGCTCGGCCGCGGCCTTATCCTCCACCGCCTCGGCCTCGGCCCCGGCGGCGGCGACGCCGAAC
AGCATGGCCTCGGCGGCCACGGCGGCGGCGGCGGCGGAGCCGATGGGCGCGACG