Detailed information on CNT30102067


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521451Oryza rufipogonSetaria italica20.717.8891.15113forward
CNT30248044Oryza rufipogonAvena sativa24.9136.5684.56136forward
CNT30668527Oryza rufipogonTriticum dicoccoides22.1621.6185.12121forward
CNT30368780Oryza rufipogonSorghum bicolor25.2731.4490.58138forward
CNT30111547Oryza rufipogonOryza longistaminata40.2977.1996.36220forward
CNT30497085Oryza rufipogonDigitaria exilis22.3419.7189.34122forward

Expression of CNT30102067

Peptides detected in this lncRNA

>peptide 1 (95 aa)
MQLSTDDETSSWRRAPYQFNCKRTQATAEVRSEHTQFLNNIRMVCHDASMQGLIHHQHHDDTSYQLAKRERWPERWPAGGEVWVARCSGRRGWPS*

>peptide 2 (29 aa)
SSSLTKSNSSYSLNKYIAKKLRKANKACN*

Sequence

>CNT30102067
CAGTTCATCACTAACCAAATCAAACTCATCTTATTCTCTTAATAAGTACATCGCCAAGAAACTAAGAAAAGCAAACAAAGCATGCAACTAAGCACCGACG
ACGAGACGTCGTCGTGGCGCCGTGCACCTTATCAATTTAACTGCAAACGCACACAAGCCACAGCTGAGGTCAGATCTGAACACACACAATTCTTGAATAA
TATACGCATGGTTTGCCACGACGCATCCATGCAAGGACTTATTCATCATCAACACCATGACGACACTAGCTACCAACTAGCTAAGAGAGAGAGATGGCCG
GAGAGATGGCCGGCCGGCGGCGAGGTATGGGTAGCTAGGTGTAGTGGCAGGCGAGGTTGGCCTTCTTGAACAAGGCGGCCTGCTCGATGGCGAACTTGGC
CTGCTTCTTGGCGGCCACGGAGTTGATGTACGCGGCGGCGCCCTCCCGGAGCAGGTCGCCGTAGCAGTCCTTGCGGCTGCTGCACAGGGCGTCCTGTAGC
GTCTGCAGCTTGCTCCCGAAGAAGCCGCTGCACACGTCCCCGAACG