Detailed information on CNT30102065


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691498Oryza rufipogonOryza sativa10.2730.591.861forward
CNT30374836Oryza rufipogonArabidopsis thaliana22.2215.7381.82132forward
CNT30712600Oryza rufipogonGlycine max21.2116.8986.51126forward
CNT30178846Oryza rufipogonSecale cereale20.0313.3685.71119forward
CNT30393023Oryza rufipogonTriticum turgidum18.5225.1783.64110forward
CNT30442853Oryza rufipogonAegilops tauschii37.2134.192.76221forward
CNT30680513Oryza rufipogonTriticum urartu10.4424.0388.7162forward
CNT30722694Oryza rufipogonTriticum spelta35.8633.1892.49213forward
CNT30352266Oryza rufipogonEragrostis tef37.5442.0890.13223forward
CNT30619906Oryza rufipogonCajanus cajan11.113089.3966forward
CNT30356611Oryza rufipogonLactuca sativa10.6123.5187.363forward
CNT30706772Oryza rufipogonPrunus avium20.3734.4785.12121forward
CNT30583061Oryza rufipogonEchinochloa crusgalli29.6332.2393.75176forward
CNT30117062Oryza rufipogonOryza nivara12.2931.7498.6373forward
CNT30113801Oryza rufipogonFicus carica23.9134.3885.21142forward

Expression of CNT30102065

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MAKWVIRTRCWQRGRGRRRRWRRGAGRSSRRRR*

>peptide 2 (54 aa)
MVIWPPRARPKVTAGLTWPPEMLAPMATATNSPNPWHTATATSPAGSSGAPPVNL

Sequence

>CNT30102065
CTGATTTCCTATTTGCGAGGAGAAGACACAAGCTTATTTTGGAGGCTACAAACAAACTGAAATGACATGGCCCGAATCAAATGAAATCTCACAATGAAAC
TCAACAGAAGTGTTCGATCTTAAACATGCATCTCATCCAACTTGCTCCACACTGATCACATTACAAATTAATCAAGAAGAAACTAAACATGGATCGATCA
TCACCCAAGTGTCACATCCTCGCAACAAAAGCCTTCTTCCCCATCTGAACCAAATCAGTCCTTCACAACACATCCTCACAAGATTCTGACGATGGAGTGA
CCACCATTTTTATGCGTGTTGCCGATGGCGAAATGGGTAATTAGAACTCGCTGCTGGCAACGGGGGCGTGGACGGCGCCGACGATGGCGCCGAGGAGCTG
GGCGATCCAGTAGAAGACGCCGGTGAGGATGGTGATCTGGCCGCCGAGGGCGAGGCCGAAGGTGACGGCCGGGTTGACGTGGCCGCCGGAGATGTTGGCG
CCGATGGCCACCGCCACGAACAGCCCGAACCCGTGGCACACCGCCACGGCGACCAGCCCGGCCGGGTCAAGCGGCGCGCCGCCGGTCAACTTGG