Detailed information on CNT30102026


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3067655Oryza rufipogonLeersia perrieri9.1334.2783.67245reverse complement
CNT30596491Oryza rufipogonOryza meridionalis31.6381.5684.1849forward
CNT30370543Oryza rufipogonOryza glumipatula9.0228.1794.63242reverse complement
CNT30105320Oryza rufipogonOryza longistaminata33.4231.6295.21897reverse complement
CNT30117023Oryza rufipogonOryza nivara38.1930.2399.411025forward

Expression of CNT30102026

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MGKSCVPKEPLLLGCVTSGQSTLFFGTDGVPFLCE*

>peptide 2 (38 aa)
MISEPLICGHGGHWMVTLTSPVQLPRACSRRKGLQVHG*

>peptide 3 (30 aa)
MHIDIYIYIEREIETDSIALFCYSGMIQLW*

>peptide 4 (34 aa)
MEWNVGMWMRGNDVQPSTNVSDSVPRMVTLMTDE*

>peptide 5 (61 aa)
MDWYGADGFDLLVATPAVTTVISSCSSLHMVCSAACVPCGILKPPECWKHGMECGNVDEGQ*

>peptide 6 (59 aa)
MPCLNLVHVFLVYAVITWVNKWQQFLLLTLMQCFKLISQQNTLPFVLLHFVSMLPVEWL*

>peptide 7 (69 aa)
MEISIWSWIKGPYNALFELSSCIFGICCDNLGEQMATVPFVDTNAVLQIDFSAKHFTFCFVAFRFYVTC*

>peptide 8 (48 aa)
MVPPVIHILHLVCAAAGYKSVARCSYLSSFIFSICVYSWLIVCYCTCS*

>peptide 9 (46 aa)
DQPFLTILPLNNQGSCGCQLDLILSSLATYPLTNVRWFLHLGWSFC*

>peptide 10 (48 aa)
MADFCRIFTGIELIHGKILCSKGTLVTRMCHIRSKYLIFWDGWSTFSM*

>peptide 11 (48 aa)
MEYLFYVNSVSMPAFSSSLPCYNGLGLVPTECNDDGDDVKPFLRQLWF*

>peptide 12 (41 aa)
MASGDLHPMSSCSGIPLLPSAESSLARRSRREGSRHPNPKS*

>peptide 13 (41 aa)
MSRLCSKRCENRVLYDGGKVKLSSLCHGDFLNGSSESFVPF*

Sequence

>CNT30102026
TGATCAACCTTTTCTGACAATCCTGCCATTGAACAATCAAGGCAGCTGTGGGTGTCAATTGGACCTGATCCTATCATCTCTGGCAACCTATCCACTCACT
AATGTTAGGTGGTTCTTGCACCTAGGATGGTCATTCTGTTAATGATAACCAGGGCAAATCCACTTACATTATGATGGATAGATGGTGGAGCAAGATATGT
GGCTGTTGGATCTTTACGGTTGAGTAAAGGCGAATCTGAGCCCAATTAGGCCTCCTATATAATGGCGGATTTTTGTAGGATTTTCACGGGTATTGAACTA
ATTCATGGGAAAATCCTGTGTTCCAAAGGAACCCTTGTTACTAGGATGTGTCACATCCGGTCAAAGTACCTTATTTTTTGGGACGGATGGAGTACCTTTT
CTATGTGAATAGTGTGTCTATGCCAGCATTTTCTTCTTCACTTCCCTGTTACAATGGACTTGGTCTTGTTCCAACGGAATGCAATGATGATGGTGATGAT
GTTAAACCTTTTCTGAGGCAGTTGTGGTTTTAAAGAACCAACTCTCACCTCTCTTGGAGTCAGTTCAACCATTCACTAGTGTTAGAGCAAGTTTAATAGT
ATAGCCAACTACTAGCTCCAAATAGTATATAGTCAATTTAATAGCCAATTTATACAACAATTACCTATAAACTTATACTCCTACACAAGTAATACATGGT
CCCACCTGTCATACATATATTACACCTAGTCTGTGCTGCAGCTGGCTACAAATCTGTTGCCCGCTGCTCTTATCTCTCCTCATTTATCTTCTCGATATGC
GTTTATAGTTGGCTTATAGTCTGCTATTGTACCTGCTCTTAGTGGTTCTGTGCCTAGGATGGTCACTCCGATGACTGATGAGTGACAAGCAGTGCAGCTC
CACTTATATTAGTATGAGTAGATTGTGGAGCACGAGGTTTGAGGAGGAAAGGCGAAACTGAGCCCGTTCAATGCCATTACACTATTCATATTGCTACTGT
GCTGATGATCAGTGAGCCACTCATCTGTGGACACGGGGGACATTGGATGGTGACTCTCACGAGCCCTGTGCAATTGCCACGTGCATGCTCCCGCCGTAAA
GGACTACAGGTACATGGCTAGCGGTGATCTCCACCCCATGAGCAGCTGTTCTGGTATCCCGCTGCTTCCTTCCGCTGAATCCTCGCTCGCTCGCAGATCT
AGAAGAGAAGGTTCACGCCATCCAAACCCAAAATCATAAACTAAATTAGCGCTTCTGCGCTGAAATACTCTTCTCCAAGAGTATTTGTTTTGAGCTCCAG
CTGAGTTTTGACAGCCCTACTTCCAACCGGTCTCTGTGTCAGTTCTCACCTCCAGGGTGCCGCCTCTGCTGCTCCATTGCCTTGGATTCATAGCAGCAAA
GGCTGGGAATCCACGGTGGAGTCTGGTGTGGCTTCCGTGTCAGGATTTAGCGGGTAGTTGCGAGATCTGATCTGATCTGATCTTAAAATCTGATGGATGG
ATTGGTATGGTGCTGATGGTTTTGATTTACTAGTTGCTACTCCTGCTGTCACCACTGTAATCTCCTCTTGCTCATCTCTACATATGGTGTGTTCTGCTGC
CTGTGTTCCTTGTGGGATTCTGAAACCTCCAGAATGTTGGAAACATGGAATGGAATGTGGGAATGTGGATGAGGGGCAATGATGTTCAACCATCCACTAA
TGTTAGTGATTCTGTGCCTAGGATGGTCACTCTGATGACTGACGAGTGATAACCAGTGCAGCTACACTTACATTAGTATGAGTAGATTGTGCAGCAAGAG
ATGTGAAAATCGGGTTTTGTACGATGGAGGAAAGGTGAAACTGAGCTCACTCTGCCATGGTGATTTTTTGAATGGGAGCTCTGAATCATTTGTTCCCTTC
TAGTTCTGATTGTATCTGTTGACCTGTGTGAAATTGAATTGTTTTGGATTTCTTGCTTTATTTCCTTTTAGCATTTACTGAAGGTTGGCTTCACATCTTT
GTGTAATAGTGTTACAATTGCCCTACATCACATGTTTGATTTGTTTGCGTGCTATGGAAATCAGCATTTGGTCATGGATAAAGGGACCATATAATGCCTT
GTTTGAACTTAGTTCATGTATTTTTGGTATATGCTGTGATAACCTGGGTGAACAAATGGCAACAGTTCCTTTTGTTGACACTAATGCAGTGCTTCAAATT
GATTTCTCAGCAAAACACTTTACCTTTTGTTTTGTTGCATTTCGTTTCTATGTTACCTGTTGAATGGCTGTGATGAATTTGGCTGCCCCTTTGTCGGTGT
TGGGAGATCTATTAACACCTCCTGAGTTGGTTCCTTGCTAAATTGATCAGCTGGTCGCCAAACTAGGAGGGCTTGCTTTGCGGCAGGTTACCAGTTTGCG
GCTATTTGCTGGCGGTGGCGGTGGTGGTGGCGGACTGAGGTTTTTATTACTTCTATGATCTAATTCTATCATGAACATGCCAATCCCATTAGATGGTTCA
TGCACATAGATATATATATATATATAGAGAGAGAGATTGAGACAGATTCTATTGCATTGTTCTGCTACAGTGGCATGATCCAACTTTGGTGATTCATAAT
GGGGGTGAAATCTGAGCCATTCCGTAAAGATTTTCTAATTTAAATTTCTAGTGTATATTGATTTCCTCGTTGTTTGTTTGTTGC