Detailed information on CNT30101967


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SMN0|CXE12_ARATH, E-value = 6e-17

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694358Oryza rufipogonOryza sativa53.9746.41100401forward
CNT30117093Oryza rufipogonOryza nivara57.664.26100428forward

Expression of CNT30101967

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MNSTLRSSSSTAWSEPAMPTKWNAWPTPLDSNSSTSPP*

>peptide 2 (33 aa)
MSRETTRVTGSVPAGTVGSPPGRKTRPLLYWQR*

>peptide 3 (49 aa)
MSITPNDHISNQISINSTGITNYFVANNGRSHHNNMAKEKEKEKFPHLI*

>peptide 4 (88 aa)
MEVHHDGELLGGHGGAGREVDASPGGAGVDVAGDDAGDGVGAGGDGGVAAGAEDAAALVLAEVGLEVEGDLGVGIHGGWGAVGGRIGRR

Sequence

>CNT30101967
AAATGTCTATAACGCCAAACGATCATATTTCGAATCAAATTAGTATAAATTCCACAGGTATTACAAATTACTTCGTGGCAAATAATGGTAGAAGCCACCA
CAACAATATGGCAAAAGAAAAGGAAAAAGAAAAATTTCCCCATCTTATTTAGATTAGACTAAACACGCTCCAAATCTGACTCCGCCGCCGGCGATCTTCA
TTTCTTGATGAATTCGACGTTGCGCTCCAGCAGCTCGACGGCCTGGTCGGAGCCCGCCATGCCGACGAAGTGGAACGCGTGGCCGACGCCCTTGGACTCG
AACAGCTCCACCTCGCCGCCATAGCCGCTCGCCTTGAGCTCCCGGTGGTACCACAGCCCCCGCTCCTTGAGCAGGACGTCCTGCTCGGCCACGCACACCT
GCACGCGCTCGCACGGGATCGCGGCGGCGGCGTGGGTGCTCGGCCTGGCGGGCGAGCCGGTGACGAACCCGCCGCCATGGAAGTACACCACGACGGGGAG
CTTCTCGGTGGACACGGCGGCGCCGGGCGGGAGGTAGACGCGAGCCCTGGCGGCGCCGGCGTGGATGTCGCGGGAGACGACGCGGGTGACGGGGTCGGTG
CCGGCGGGGACGGTGGGGTCGCCGCCGGGGCGGAAGACGCGGCCGCTCTTGTACTGGCAGAGGTAGGGCTGGAAGTCGAAGGCGACCTCGGAGTCGGGAT
CCATGGCGGATGGGGAGCGGTTGGTGGCCGGATCGGGAGACGG