Detailed information on CNT30101929


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30101929

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MQTNTLHVHHHLNVFLCTTCFRLLVIGILYSSWNVGVHEV*

>peptide 2 (58 aa)
MYFYALRAFAFWSLAYFIAAGMWVFTRYELQLMHLGSKLNMDASSFWSIAVAFHSFLKL

Sequence

>CNT30101929
TTATAATATGAATATTTAATAATAGCAATGGCAACAGTGCATAGTAAGCGGTCTCACTGCCATTGATGAGGGTTCCCGCCCGACACAGATGACTTTTATT
TTCTCGAAAAACGTAGGAGAACTGTGCCTCATTATATTAAGAAGAGAGAAAAGGGGCTAGAGCCCTACAACACACACCACTCCACACAACTCCGACACGG
ATGACTTATTCCGCATAATTGAGCTATCACAATCTTAGCATTATAATATTTTTCATATAATAATAGCAATATATTCAGCATGCAAACTAACACCTTGCAT
GTACACCATCATCTAAATGTATTTTTATGCACTACGTGCTTTCGCCTTCTGGTCATTGGCATACTTTATAGCAGCTGGAATGTGGGTGTTCACGAGGTAT
GAGCTCCAGTTAATGCACTTAGGATCAAAATTAAATATGGATGCATCATCATTTTGGTCCATAGCCGTCGCCTTCCACAGTTTCCTCAAGTTGG