Detailed information on CNT30101892


BLAST search results

BLAST vs Swiss-Prot:
sp|A2Y5L9|PDC1_ORYSI, E-value = 3e-94

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522505Oryza rufipogonSetaria italica36.4457.9294.62223forward
CNT30640997Oryza rufipogonNymphaea colorata21.7334.9185.71133forward
CNT30562761Oryza rufipogonActinidia chinensis36.1119.9688.69221forward
CNT30136353Oryza rufipogonLolium perenne57.1938.5991.43350forward
CNT30202534Oryza rufipogonHelianthus annuus21.928.0382.09134forward
CNT30362074Oryza rufipogonSorghum bicolor44.1247.9691.48270forward
CNT30355916Oryza rufipogonLactuca sativa32.6837.7480200forward
CNT30576296Oryza rufipogonOryza barthii71.4192.7898.86437forward

Expression of CNT30101892

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MTALELTTGSEPTELHDGFATPFEGLPTRASSMARKRRWQ*

>peptide 2 (42 aa)
PVRSPGGRWCGGGCGWCRSRWSWARRRCRSRGGSRCRRRRWR*

Sequence

>CNT30101892
TCCTGTGAGAAGTCCGGGAGGCCGATGGTGTGGTGGAGGATGCGGTTGGTGCCGTAGTCGTTGGAGTTGGGCCCGCCGACGATGCAGATCACGGGGAGGT
TCTCGCTGTAGGCGCCGGCGATGGCGTTGAGCACGCTGAGCCCACCGACGGTGAACGTGACGGCGCACGCGCCGACGCCGCGGGCGCGGGCGTAGCCGTC
GGCCGCGTACCCGGCGTTGAGCTCGTTGCAGCAGCCGATGAGCGTGAGCCCGGGCTCGGCGATGAGGTAGTCAAGCAGGGTGAGGTTGAAGTCCCCGGGG
ACGGCGAACACGTCGGTGGCGCCGATCTGCACGAGGCGCCTCGCGAGGTGCCTGCCGAGCGTGGCGCCCGCCGCGCTGGTCACCGGCGAGTGGATGACGG
CGTTGGAGCTGACGACGGGCAGCGAGCCGACGGAGTTGCACGACGGCTTCGCCACGCCATTCGAAGGGTTGCCAACCAGGGCAAGCTCCATGGCGCGCAA
ACGAAGGTGGCAGTGAGGCGCGGTTTGACTTGGTGCGAACGCTTGACTTGTCTTGGACTTGTGTTGCTTGTGGCTAGCTGAAATTGTACGAGGTTTTAGC
TGTGAGTTGTGA