Detailed information on CNT30101869


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005084, E-value = 7e-179

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369281Oryza rufipogonOryza glumipatula49.1428.8798.53341reverse complement
CNT30107966Oryza rufipogonOryza longistaminata46.1145.7896.88320forward
CNT30577841Oryza rufipogonOryza barthii9.826.1586.7668forward

Expression of CNT30101869

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MYVFKFLGWGLNNVILSFFVVNVLVMNVHE*

Sequence

>CNT30101869
GGGCAAACTAAAATGGGTTTGCTGATTCATTTATATTATTTGCTTACATCAGAATAGTAGGATCCTAATAACACATCACAGATGATCACACATACAATGG
TAGAATGGATTTCAATGCATTGACATCCATGTTCAATTAATCAGTTTGGCAACAATCTAATATGAAACAATAGCAATGCCAATCTCATCAGCTACATCTG
AGATGTAATTTGAATATTAATTCTTAAGCTTAGATAACCAAAGAGGTAGTGCAACTAGAAAAGAGTTGACGAATGGTATCGCAGGCAGTCCGACAACACC
TCAAATAATATGCAGATGAGCCAGTTGACTTGCAGATCCTGAGATTGCAAAAAAAGAGGTTTTGGTGATCGGGACCAAAATATGTCCAAAGGTGGCTGGA
TCAGTTTGAATTTTGTGAGCTCAAGCTCCTCTGGGAGGATTTAAGCCAAGGAGTACGTTAGGAGGCTTTGGCCTATGCGTATATGTAACCTGATATGTGT
GCATTAGGAGGGCTGTGGCCTATGGGTGTATGTGAACTGTGATACATGTGAAGCTATTTTGATGTATGTATGTTTTCAAGTTCTTGGGTTGGGGGTTAAA
TAATGTGATATTAAGTTTTTTTGTTGTCAACGTTCTTGTTATGAATGTCCATGAATAAAGGGGAGATTATGCGAAACTTTTAATAAATTTCGGA