Detailed information on CNT30101862


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553839Oryza rufipogonOryza glaberrima58.18102.3796.44562forward
CNT30370219Oryza rufipogonOryza glumipatula99.59100.195.74962forward
CNT30116861Oryza rufipogonOryza nivara58.18102.3796.44562forward

Expression of CNT30101862

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MPKYYNHQFITSQTSTHVLSKNYIKSDCSLPPLLARSTGDEHISHKTRQDYNTHCLLMV*

>peptide 2 (32 aa)
MRRRRTSRGRRRRRSGNGGGGARSTSSEYGER*

>peptide 3 (91 aa)
MKQTIIKHNKHHQTTTEASTTSCNAAATMPLMPMAMACELSMVAQNWKASAMAVATTWSQYGSCPKLNPRTGSLQEIKKIPKNTRKKLVGG*

Sequence

>CNT30101862
GATAGATTCATTGCTGCAAACATTATAGCATAGGTTCAATGCCAAAATATTACAATCATCAGTTCATCACATCACAAACCAGCACACATGTGCTCTCCAA
GAATTACATCAAATCGGATTGTTCTCTTCCACCCTTATTAGCAAGGAGCACTGGAGATGAACACATCTCACATAAGACTAGACAAGATTACAACACACAT
TGCTTATTAATGGTCTAGATTAATGAAAACAACATGAAGCAAACCATAATTAAACATAATAAGCATCATCAGACAACCACAGAGGCTAGTACTACTAGTT
GTAATGCAGCTGCAACCATGCCATTGATGCCAATGGCCATGGCGTGCGAGCTCTCCATGGTGGCTCAGAACTGGAAGGCGTCGGCCATGGCGGTGGCGAC
GACATGGTCACAGTACGGTTCTTGTCCAAAACTTAATCCAAGAACCGGATCTCTTCAAGAGATCAAAAAAATTCCAAAGAACACAAGAAAGAAACTAGTA
GGAGGATGAAAAAGAAATCAAGATCTAATCAATTAGAGGCTGGAGATGGTGTTCTTGGGAGGAAGGCGATGAGTTCATGAGAAGACGTAGAACCAGTAGA
GGAAGGCGACGGAGAAGGAGTGGGAACGGCGGCGGCGGAGCACGTTCAACTTCATCGGAGTACGGCGAACGTTAGAGGTAAGGATAGGTAAACATTCCTC
AGATCGGATCTACGCCACCAACCTCAACCTCGACCAAGAACAAGAACAGCAACGACTCCGCGAGGAGAGGGAGTGGAAACTAAAATTCGACCAACCCGAG
GGGCTTCCTCGCAAGAATGCAAGGAGTAGACTCGAAAGAAAAAGAAACTAGGAGGACCTGAATGTAATAAAAAGATGGGAACCAAAGGACTTATCTGCGA
AACAGAGGGGACTCCGGGGGCTCTAATGCATAAGGGGCGCAATTAGACGGATGGGGAAGGTTTAGA