Detailed information on CNT30101831


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693833Oryza rufipogonOryza sativa98.1310099.68630forward
CNT30553643Oryza rufipogonOryza glaberrima99.6999.0799.22640forward
CNT3067518Oryza rufipogonLeersia perrieri28.3534.2785.71182forward
CNT30596240Oryza rufipogonOryza meridionalis78.8295.4797.04506forward
CNT30370327Oryza rufipogonOryza glumipatula99.5399.8499.37639forward
CNT30108575Oryza rufipogonOryza longistaminata86.7693.9397.49557forward
CNT30576567Oryza rufipogonOryza barthii98.9199.3799.37635forward
CNT30116760Oryza rufipogonOryza nivara99.0710099.37636forward
CNT30604159Oryza rufipogonOryza punctata34.8942.2688.84224forward

Expression of CNT30101831

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MDSNNKNLQPPPGYPTVDSEHGGRGRTTARGRKTRFIDGCIAALCCCWLCDLCCD*

>peptide 2 (35 aa)
MDASPHYAAAGCVTFAAIRGRETDEIKRCLDIICG*

Sequence

>CNT30101831
ATCTCAATTCAAACAACACAAATTTGACAAAGAAATTAACGCAGCTAGCTACTTGATCAAAGAAACCTCTCCTTGATCTAGTAGTGCGAGCTAGCTAGTT
ATAAATTCGCAGTAGAACGCAGCCAGTGTGTAGCTAGCATGGACAGCAACAACAAGAACCTGCAACCACCACCAGGCTACCCGACGGTGGATTCAGAGCA
CGGCGGCCGCGGACGAACGACGGCTCGCGGGAGAAAGACCAGATTCATCGATGGATGCATCGCCGCACTATGCTGCTGCTGGCTGTGTGACCTTTGCTGC
GATTAGAGGAAGGGAAACAGATGAGATTAAAAGATGCCTTGATATTATATGTGGATAATATTTCTACATGGGTGTGCTGAAAAGAGGATCTTTGGAGCAG
AGAATTGAATACAACGAAATGTTGTTGCAGAAAGTATACATCCCGTAATTTCTGCGTATATTTTCGATATATATATAGCGCGGAATAATGAATAATGATA
TGCGTGAAGTATCTATGTAATTCATTAATTACATAGTGTGCTCGTTTTGATTTGTATCCATTTTTCAGCTCATTTATTTTGACCCATATAAAAATGTATA
GATAATCTGATTCCTCAATTGATGAGTTAATCTTTCCTTGGC