Detailed information on CNT3010182


BLAST search results

BLAST vs Swiss-Prot:
sp|P36213|PSAD_HORVU, E-value = 3e-69

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678430Zea maysSetaria viridis23.0634.3596.69181forward
CNT30315306Zea maysCorylus avellana15.9220.6380.8125forward
CNT30710271Zea maysGlycine max32.7451.6182.49257forward
CNT30395090Zea maysTriticum turgidum33.2524.2892.34261forward
CNT30665756Zea maysTriticum dicoccoides28.6631.6992225forward
CNT30344027Zea maysEragrostis tef33.7632.894.72265forward
CNT30358694Zea maysLactuca sativa16.3128.7685.16128forward
CNT30558912Zea maysPanicum hallii8.5426.0794.0367forward
CNT3049718Zea maysCucumis sativus19.3629.1281.58152forward

Expression of CNT3010182

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MHVYGAPPAASLIINIRRRRSPLIWITGRAGGRRDV*

>peptide 2 (37 aa)
PTLNTFIRPLIVLSSKHQKLINALLKDSGVMATLSYA*

Sequence

>CNT3010182
GTCCAACACTTAACACTTTTATTAGACCTTTAATTGTGTTGTCATCCAAACACCAAAAACTCATAAATGCACTATTGAAAGATTCAGGTGTTATGGCAAC
GTTGTCATATGCATAGACATGAGGAGCAGATGCACATGTACATAGAGTCCCACGCTGCGCCTCCACGGTCACCAAGAAATTACTAAAACAAATTACACAT
CCATGTCCACATATATTTAGATCAAACCATGCATGTATATGGCGCACCACCAGCAGCTAGCTTAATTATTAATATAAGAAGAAGAAGAAGTCCTTTGATT
TGGATCACCGGCCGGGCGGGCGGGCGGCGTGATGTGTGATTAGTCGAAGGTGCTCTTGCCGGTGAACTTGACGTCGATGGGGTTGACGTTCTTGCCGATG
CTGCGGAAGTACTGCACCTCGCCGTTGGGGAAGACGCGGTAGAACTGGTAGGTGATCTTGTACTTGGAGCGCAGCCTGGTGCCGAGCGCGAGGCACTGCT
CCTTGCGCGCCAGCTTCAGGAGGTTGGGCCCCTCCCGCATGATGGCGGCGCCGCCGGTGGGCATCTCGAACACCTGCTCCTTGGGGGACACCCACGTGAT
GACGTAGAACTCCTCCACCTGCGCCTTGCGGAGCAGCCCGCCCGTGCTGCCGCCGAAGATCGGGGACGGCGTGCTGGGCGCGAGCTGTGAGCTTAGCTGC
CGCGGCTTCGCCGACGGCGCCCAGGCGGAAGCGGCGGCGGCCACCAGGTGGCGCGTGGCCGCGGAGGCTTGCGTGGCCATGGCCA