Detailed information on CNT30101813


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693682Oryza rufipogonOryza sativa53.7538.9199.6251reverse complement
CNT30553667Oryza rufipogonOryza glaberrima53.7526.96100251reverse complement
CNT30108234Oryza rufipogonOryza longistaminata52.4625.4995.1245reverse complement
CNT30576409Oryza rufipogonOryza barthii53.7528.52100251reverse complement
CNT30116872Oryza rufipogonOryza nivara53.7526.76100251forward

Expression of CNT30101813

Peptides detected in this lncRNA

>peptide 1 (38 aa)
HLRVDERGDVSVRMFDQLSVSPLFLSNNVLRSPSRMCL*

Sequence

>CNT30101813
TCACCTGCGCGTGGATGAGCGGGGAGATGTGAGTGTGCGAATGTTTGATCAACTATCGGTCTCTCCATTGTTTTTGAGTAATAATGTGTTAAGGTCACCC
TCACGGATGTGCTTGTAGCCCTTGCCGCCGCTGGATCCGCCTGCTAGAGCCCTTGCTGTTGCCGGATTTGCTCGTGAGAGCACCAAACACCACTAGCGCT
CGATCCGCCTGTTGCTGCCACCTCCGGATCCATGCAGTTGTTGATGCTGGTCGTTAACAGCAGTATGCCGACGAGCTCAAGGAATTATTGATTGGGAGCA
TGCCAAGGCACCATCGAGAGGGAGGAGGCACGACGTAGGGGGAGATGAGGGGTTGTGGCGGAGGCGGTGGTGGCTCGTGGAGCAGGGATTGGGGAGATGG
GAGAGGGAGAGAGTAGGGGGAGAGGAAGTGAGCGAACGTAGAGCCGTGGAGGTGAGGGAAGCCGGTT