Detailed information on CNT30101794


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30576291Oryza rufipogonOryza barthii36.6760.94100220forward
CNT30116825Oryza rufipogonOryza nivara64.6768.19100388forward

Expression of CNT30101794

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MMIDDPSKLARDPSNIDRHTHTLTTTTTVLFRRQSKRQGLPTYKLGTNASKLRPRSKL*

>peptide 2 (33 aa)
VSSKRNGMKAEVDYIKKPGTHEEMEQEYMMRSP*

>peptide 3 (45 aa)
MQPGDDDDRFSCRSSRSSRCSWCHTCSRSCRRSKTSSSWEGEGLN*

Sequence

>CNT30101794
GTAAGCAGTAAGAGAAATGGGATGAAAGCAGAGGTAGATTATATTAAGAAGCCTGGCACGCATGAGGAGATGGAGCAGGAGTACATGATGAGATCACCAT
GATGATAGATGATCCATCCAAGCTAGCTAGGGATCCATCCAACATTGATCGACACACGCACACACTGACAACGACGACGACGGTTTTATTTAGGCGTCAG
AGCAAAAGGCAAGGCCTGCCTACATATAAGCTGGGTACTAATGCAAGCAAATTAAGGCCTCGATCAAAGCTCTGATCGACAGTAGCAGCATCCATACGAT
AAATCCTCATGCAGCCGGGCGACGACGACGATAGATTCAGTTGCAGGAGCAGCAGGAGCAGCCGCTGCAGCTGGTGCCACACTTGCAGCCGCAGTTGCCG
CCGCAGCAAGACATCTTCTTCTTGGGAGGGCGAAGGACTTAACTAAGCAAGAAGGAGATAGATGTTGTTGCTGATTGAGCTCAAGAATTGCTTCTTGCTT
TGGTTGCTGATGAACTGATGATCGAGGAGGAGGTGGTATATATAGGCGGGAGAGCAGCGAAGCGTACTGTGGCGAGATGCGGAGAAAGAATGGAGGTGAT