Detailed information on CNT30101773


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0DG05|PSAH_ORYSJ, E-value = 2e-49

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693422Oryza rufipogonOryza sativa63.5973.9199.81524forward
CNT30673198Oryza rufipogonSetaria viridis13.7149.5695.58113forward
CNT30520893Oryza rufipogonSetaria italica15.6635.3494.57129forward
CNT30532753Oryza rufipogonEucalyptus grandis12.541.5383.5103forward
CNT30178026Oryza rufipogonSecale cereale16.1423.8482.71133forward
CNT30285918Oryza rufipogonTriticum aestivum13.1122.9889.81108forward
CNT30384456Oryza rufipogonTriticum turgidum13.1120.1989.81108forward
CNT30591852Oryza rufipogonMusa acuminata11.6523.0291.6796forward
CNT30435366Oryza rufipogonAegilops tauschii13.1123.7490.74108forward
CNT30240454Oryza rufipogonAvena sativa13.1130.6894.44108forward
CNT30655703Oryza rufipogonTriticum dicoccoides13.1130.0890.74108forward
CNT30131217Oryza rufipogonLolium perenne13.1121.6494.44108forward
CNT30679604Oryza rufipogonTriticum urartu13.1132.1490.74108forward
CNT30370255Oryza rufipogonOryza glumipatula70.1590.7499.83578forward
CNT30704201Oryza rufipogonPrunus avium10.4433.284.8886forward
CNT30149479Oryza rufipogonBrachypodium distachyon15.2932.7388.1126forward
CNT30576447Oryza rufipogonOryza barthii36.4110099.33300forward
CNT30496573Oryza rufipogonDigitaria exilis16.52595.59136forward
CNT30116717Oryza rufipogonOryza nivara81.4381.6398.96671forward
CNT30604129Oryza rufipogonOryza punctata27.7936.5293.89229forward

Expression of CNT30101773

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MYLRVVRQSALHGDRLDGDEGRHCCGEFAGGRKAE*

>peptide 2 (33 aa)
MAIRPWGTSSTVQRICMDGSDQEEGEAETRNLI*

>peptide 3 (37 aa)
MQHRIGSFTTYIAIGIVQLYQHHKQGELIHGDPAMGD*

>peptide 4 (61 aa)
MSVIRIEHGISGLKPRTPLATAISSASPLLLAYSSYVPAGGAAERPSRRQAGRRRGTPLLR*

>peptide 5 (30 aa)
KIEGRQKIKTEHMGSQYVACSIELDPLQLI*

>peptide 6 (42 aa)
AKSRGDRKLKPNTWDRSTSHAASNWILYNLYSHRNSTIISTS*

Sequence

>CNT30101773
GCAAAATCGAGGGGAGACAGAAAATTAAAACCGAACACATGGGATCGCAGTACGTCGCATGCAGCATCGAATTGGATCCTTTACAACTTATATAGCCATA
GGAATAGTACAATTATATCAACATCATAAACAGGGGGAATTAATCCATGGCGATCCGGCCATGGGGGACTAGCAGTACGGTACAGAGGATTTGCATGGAT
GGATCGGATCAAGAAGAAGGTGAGGCAGAGACGAGGAATTTAATTTAGATCTTGCCGCGTGGGCCGGGCGTCGGCGGCAGCTGCGGGCCCTTCTTGATCG
GAAGCAGGAACTTGAGCAGGAGCCCCCTCTTGGTGAAGGGCCCCGCGAACGTCTCGAAGAACTTGCTCTGCATCGATCACCCACACGAATTATTCAGTAA
ATTAATCATCGAGCTAAGTATATATTTTAGTCAGGTAATACTAACCTGGAGAGGGTTGTACGGCGACGGCGCGTCGGAGCCGTACAGGTCCCACTGCCCG
GTGGTGTTGCCGATGTCCTCGAGGTCGAAGTAGACGCTCTTCTCGCCGTACTTGGCCACCACGGCGGCGCGCGGCCTGTAGCAAAGAAATTATGAGCGTG
ATAAGAATTGAACACGGGATCTCGGGATTGAAACCACGTACACCTCTTGCCACTGCAATATCAAGTGCATCTCCACTGTTACTCGCGTACTCCTCGTATG
TACCTGCGGGTGGTGCGGCAGAGCGCCCTTCACGGCGACAGGCTGGACGGCGACGAGGGACGCCATTGCTGCGGTGAATTCGCGGGAGGACGCAAAGCTG
AGTAGATAGATGGATAGATAGCCG