Detailed information on CNT30101771


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004984, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30110013Oryza rufipogonOryza longistaminata63.3655.3894.26453forward
CNT30116855Oryza rufipogonOryza nivara94.6910098.82677forward

Expression of CNT30101771

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MFSSSVLKAVAREGPDCFFSFFLGPFLQMLIQTVIYPALRGCSAKLDVLPSVLCAHKHFSL*

>peptide 2 (31 aa)
LAHNRCTFPGFTLALYSAKACIASIGSHLSL*

Sequence

>CNT30101771
TTTAGCACACAACAGATGTACATTTCCAGGTTTCACTTTGGCACTATACAGTGCAAAAGCTTGCATTGCTAGCATTGGCTCCCACCTCAGTCTGTGAGTT
CTTCTCCGGCGAACTATTTCCAAGGAAGATGATGCTTTTCTAGTTGTCCGACGACGAACATCTTCAAGGCGACTGAAGTATTCTAGTTTTGCTGAGAGGG
CTTTAACCTCCTGTGTGGAGGCCCTTTTGGGTATGCTCCTCGGTTTCTTATGCAGATCGCTGAGTTTTCTTTGCTCTTGTCGCTGGTAGTATAGATCAGC
TTGTCATCTTTGAAAACACAGCCTTTACGTTGATTACCTTCTTCAGCTTAGGTGGAAATCTTATGTGGTGTGGCTGATTTCATATACTATTGGTAAAAAC
CTAAACCTCCTGAGCGAGGCCCCTCTTGGGATCGTGCTGAGACTCCATCTACTGCAGCTCACCTTGGTTCAATCTCCATCAAAGTAAAAGTTCATGTTTT
CTTCATCAGTGCTGAAGGCAGTTGCAAGAGAAGGACCCGATTGCTTTTTCTCTTTCTTTTTAGGTCCTTTTCTACAAATGTTGATCCAAACTGTAATTTA
CCCAGCTTTGAGGGGCTGTTCTGCAAAACTGGATGTACTACCCAGTGTACTCTGTGCTCATAAGCACTTCTCTTTATAATAATATATATGTTGGTATTTG
CTTTCAAAAAAAAAA