Detailed information on CNT30101746


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30382729Oryza rufipogonTriticum turgidum15.125.281.37161reverse complement
CNT30553647Oryza rufipogonOryza glaberrima99.3496.0197.361059forward
CNT3067525Oryza rufipogonLeersia perrieri36.9646.9686.55394reverse complement
CNT30596287Oryza rufipogonOryza meridionalis23.9248.9498.04255forward
CNT30370201Oryza rufipogonOryza glumipatula99.3487.397.261059forward
CNT30576582Oryza rufipogonOryza barthii59.4756.4697.95634forward
CNT30116754Oryza rufipogonOryza nivara99.3496.196.981059forward
CNT30604109Oryza rufipogonOryza punctata101.3198.2793.061080forward

Expression of CNT30101746

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MVPFPFNSFFIFQDGEETAQPANQHPPKGTNTGLG*

>peptide 2 (68 aa)
MKVAARRRRRLLGKGLPWCHSLLIHFSSSKMVRRQLSQPISIHPRALTLAWDEISGMTSCCCSDLCYW*

>peptide 3 (71 aa)
MVTERRRGGVQMSISTKAMIAATRSPMRLNAASSSDSSVQHTLPISALAEEDQITNLLVIGGMLKQDESGS*

>peptide 4 (35 aa)
MSCLLIIWHMFFGKVKHGNMPCSNATLVSIYLFTL*

Sequence

>CNT30101746
AAAGCTATCAATTCAGGCTAAAGATGAAGAGACTATTATACCAATAAACATGACTTACAATAGGATGCATTACAATTAAGCAATTATTTAACTTGAAAAA
TCAGGTGCCAATGCCTTGCCTTCCTGCTTTCTCCAACAACCTTCACCCTGCACATCTTTGATTCTTCAGAGAAGCAATCAAGCTTCTCCCATCAGAGGAC
TCACAGTCCTGCAGGTACTCCTCCACCTCAGCAGCAAGGGTAGATGGTGACTGAGCGCCGCCGTGGCGGTGTGCAGATGAGCATCAGCACCAAGGCGATG
ATCGCAGCGACGAGAAGCCCCATGAGGTTGAATGCGGCCTCCTCTTCGGACTCCTCGGTGCAGCACACCTTGCCCATATCAGCACTAGCAGAGGAAGATC
AAATAACAAATCTCTTGGTGATAGGTGGTATGTTGAAGCAGGATGAAAGTGGCAGCTAGAAGAAGAAGAAGGCTTCTTGGCAAAGGTCTCCCATGGTGCC
ATTCCCTTTTAATTCATTTTTCATCTTCCAAGATGGTGAGGAGACAGCTCAGCCAGCCAATCAGCATCCACCCAAGGGCACTAACACTGGCCTGGGATGA
AATTTCTGGGATGACCAGTTGCTGCTGCTCAGATTTGTGCTACTGGTGATTTTGTCGCAGTCAATTCGATGATGGTTGCTGATGGTGAGATGAGATGAAA
ACTACACTGGATGTACTGATGATACTCCTGGTGAACTTGCAAAAGTTCAGATATCTTACTTTCTGAAGGTTGTTGAAAAGTAATTCACTTCTTCGGTTAT
TGAAGTCCTGGAAACAAAACAAGGTTGATTAGCATTTGCTGATGGCTACATTTCATTCCCTGTGAAACACATCTCATTCAGGTTCAGCATTAGAGTTGAG
GTAGTAGCAAACATTGGGTGGCACATGTGTGTCGGTGTGACTTAGACCTGCAATGAGTTGCCTTTTAATAATCTGGCACATGTTTTTCGGGAAGGTGAAG
CATGGCAACATGCCTTGTTCCAATGCAACTCTTGTATCTATCTATTTATTTACTCTATGAAATTCC