Detailed information on CNT30101681


BLAST search results

BLAST vs Swiss-Prot:
sp|P31155|METK1_PETCR, E-value = 6e-70

BLAST vs NONCODE:
NONATHT001922, E-value = 2e-15

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520776Oryza rufipogonSetaria italica14.2154.0991.48364forward
CNT30641080Oryza rufipogonNymphaea colorata12.0234.4184.42308forward
CNT30381493Oryza rufipogonManihot esculenta7.3825.2383.6189forward
CNT30402686Oryza rufipogonBeta vulgaris8.3535.4983.18214forward
CNT30218668Oryza rufipogonKalanchoe fedtschenkoi9.663.5783.33246forward
CNT30650126Oryza rufipogonRosa chinensis31.373.8582.67802forward
CNT30620812Oryza rufipogonCajanus cajan12.1825.1278.53312forward

Expression of CNT30101681

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MAAGGRLRITMLSSEETKHHNGTEQKLPKGSF*

>peptide 2 (61 aa)
MCPWSPAPISSGRLVKWPCTPCAMSGDCCSMFTSTLQWSASRPTSADTKPMLRHVSLTIFS*

>peptide 3 (67 aa)
MTMFVLVQVSQATLLSGSSARQASSTASETWSQSLSGWPSFTDSEVKRKVSSAAIFSYLHKMVFHIL*

>peptide 4 (83 aa)
MMIMPGLKSKFSFTILRISLSGILPVPYVSTNTDSGSGTPMAYDTWTMQRRARPLATMLLAACLATYAPLRSTLVGSHSCEPP*

>peptide 5 (89 aa)
MLHCGQPWLGPILANLRKTSAKLGSKDMAEGHQLRGLISCISKHVSLVTSTNLLRALGEVAVHTLCNVRGLLLDVHKHLAVVSIETDIS*

>peptide 6 (99 aa)
MIRPQDNQPRAQIQPESLILPRTLKPSSPFSSRKNEGRSRTAAAAAAAATHTQQRYQQRGQGNRRLTCGGGGGGGGGGAGPIRSGGGGGGGGGKLIRSDR

>peptide 7 (60 aa)
MKGEAGQQQQQQQQQHTRNNATSNEDRGIGGSPAAAVAAAEEEEPGRSDRGEEEEVEEVN*

>peptide 8 (51 aa)
MYCNYHINIPLLGVNISWRPGKKERNRWLAFRGSTILFTCNLSTKTNIINH*

>peptide 9 (48 aa)
MVYATKFVLSKQVKKTVARNKTFLLILYIAYVRQDAVLLAPDKTTILG*

>peptide 10 (36 aa)
MLFISKPFDKHQGIKHLKGSHPTVSLSISIHNNKQA*

Sequence

>CNT30101681
ACATAGGAGGTTTCATTTCTTCTTCTCAAAGTAGTGTAGCATCTTTCCTTCTTTCACCATTACATAAGCTTAAGCAATAACAGATAACAAATCATCCTCC
TCCTCCTCTAGGTAAAATATTCAAACACAATACCCTTATAAGTACTTATTATTAGGAAAGTAGCGTGCATGGGCATAAATGGCAGCGGGGGGCAGGTTAA
GAATCACAATGCTGAGCAGCGAGGAAACAAAACACCATAATGGGACAGAGCAAAAGCTTCCGAAAGGGAGCTTTTAGGCAGAAGGCTTCTCCCACTTGAG
GGGCTTCACCACCTCCCAGGTGAAGTCTGGGTCGTCCCTTCCAAAGTGACCGTAAGCCGCCGTCTTGAGGTAGCGTCCGTTGCCGCCTTTCTTGAGGTCA
AGGTTGATGATGATCATGCCAGGCCTGAAGTCGAAGTTCTCCTTCACAATCTTGAGGATCTCCTTGTCAGGGATCCTGCCAGTGCCGTATGTGTCGACGA
ATACGGACAGTGGCTCTGGGACACCGATGGCGTATGATACTTGGACAATGCAGCGGCGAGCAAGGCCACTAGCAACAATGCTCTTGGCAGCTTGCCTTGC
GACGTATGCTCCACTGCGGTCAACCTTGGTTGGGTCCCATTCTTGCGAACCTCCGTAAGACGAGCGCCAAGCTTGGTAGCAAGGACATGGCTGAGGGGCA
TCAACTCAGGGGTCTCATCAGTTGCATATCCAAACATGTGTCCCTGGTCACCAGCACCAATCTCCTCAGGGCGCTTGGTGAAGTGGCCGTGCACACCCTG
TGCAATGTCAGGGGACTGCTGCTCGATGTTCACAAGCACCTTGCAGTGGTCAGCATCGAGACCGACATCAGCTGACACAAAACCGATGTTACGGCATGTC
TCCCTGACAATCTTCTCATAGTCGACGTTAGCCTTGGTGGTGATCTCACCAAAGACCATGACCATGTTTGTCTTGGTGCAGGTCTCACAAGCGACCTTGC
TGTCAGGGTCCTCGGCGAGGCAGGCATCAAGCACAGCATCTGAGACTTGGTCGCAGAGCTTGTCAGGGTGGCCCTCGTTCACAGACTCCGAGGTAAAGAG
GAAGGTATCAAGTGCGGCCATCTTCTCCTATCTGCATAAAATGGTATTTCACATACTTTAGACAAAGAAATATCATGAATAAAATGGACATGGTGAGCCT
ATGAGAAAAAAAGGGGTATAAGTGATAGCTAATGTGAAGGGAAGCTGATAGCGACAATTGATTTCTGGAAATGCTTACATAACACACTGAGAGGACAATA
CTGATCCCTAGAACAAATGGTTTATGCAACAAAATTTGTCCTGAGTAAACAGGTTAAAAAAACAGTAGCAAGGAACAAAACATTCCTTTTAATCCTCTAT
ATAGCTTATGTACGCCAAGATGCTGTTTTGTTGGCACCTGACAAGACCACAATTTTGGGCTAAAATAGTTGTCCCTACAAAGAGTTGACTAAGTTCCTAA
GTTCCTTGGGCAAGTGTTAGGTATTTGTAATATTCTCTACAAGCGCAACAAGCAGGTATAGAGCACAAGGAATCTAACAATTTTCTGCCGGAATCAGCAT
AAACGCATAATCAATCGTGGTGCCACTATGTATTGTAACTATCACATAAATATACCACTTTTAGGGGTAAACATATCCTGGAGACCTGGAAAAAAAGAGC
GAAATCGCTGGCTAGCTTTTAGGGGTTCTACTATACTCTTTACATGTAATCTTTCCACAAAGACAAACATCATAAATCATTGAACATGCGCATCAACTAA
TCAAGCACATAAAACAACAGCAGAAACATATCAATTCGTCTTGGCATATTTAACTTTGAAGTGGCACCAATCAATTATTTTTTCCATTTTCCGTTCATTT
ATAAGAATTCCAACTCCCAAGACCAAGGGGATGACTCGAATCTACCGCAGAACAGTCAAATGAGCTGACAGCCAAAGACATAATACTAGCACTAAAACCA
CTGCTCTAGCATGTTGTTTATCAGCAAGCCGTTTGATAAGCATCAAGGTATTAAACATCTAAAAGGAAGTCATCCTACTGTTTCTCTCTCCATCTCCATC
CATAATAATAAGCAAGCATGACAAAAATAAAACTTACAACACCTAAATCCAACCAAAGAAACCCCATCTAAATCTACCATACCACAAGATCGAAAGAAAA
GCAATAAACCCTCCTTATAACCCTCCCAAACCAGCACAAACAAATCAATATCTAGGCACGATGATACGTCCGCAAGACAACCAACCACGAGCTCAGATCC
AACCTGAGAGCTTGATCCTACCAAGAACGCTAAAACCCTCCTCTCCCTTTTCAAGCCGCAAGAATGAAGGGAGAAGCCGGACAGCAGCAGCAGCAGCAGC
AGCAGCAACACACACGCAACAACGCTACCAGCAACGAGGACAGGGGAATCGGCGGCTCACCTGCGGCGGCGGTGGCGGCGGCGGAGGAGGAGGAGCCGGG
CCGATCCGATCGGGGGGAGGAGGAGGAGGTGGAGGAGGTAAATTAATTAGATCCGACCGGGC