Detailed information on CNT30101666


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693609Oryza rufipogonOryza sativa35.8660.0599.6251forward
CNT30444732Oryza rufipogonSaccharum spontaneum20.1410.0285.82141forward
CNT30116873Oryza rufipogonOryza nivara3939.1798.9273forward

Expression of CNT30101666

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MFICANFSFLCSNMVEQIIQLEIRRSSGRMSLNGIKKLNLLRASKVVDIGTPQKKITFFVLKLLMLQRLGYLHC*

>peptide 2 (35 aa)
MDEHRRLLCSEIERLRHYKQWKDKCNNPCSSLKKR*

>peptide 3 (68 aa)
MLKSEEKVIRLSKEKDQLLKERDAALQEAHMWRTELGKAREQAVVQEATIARVDEMLRASEADAWVYCL

Sequence

>CNT30101666
GAACTATCTTGCCAGTTATCCTTTTGTTTAATTGAAATGCATAATCATGTTCATTTGTGCTAATTTTTCATTCTTATGTAGTAATATGGTGGAACAAATT
ATCCAACTGGAGATAAGAAGGTCTTCTGGGAGGATGTCTCTGAATGGTATCAAGAAACTGAACCTCCTCAGGGCTTCCAAGGTAGTAGACATTGGAACTC
CTCAAAAAAAGATTACTTTCTTTGTTCTGAAACTCCTGATGCTGCAAAGGCTTGGATATCTGCATTGCTGAGACTCTTCGGGTGAAAGATGGGGAGTTGC
AGAATTTGGCCAACAATATTCGTGCTCGGGATGCTACAATTAAGGAAATAGCAGATAAATTAACACAGACTGCACAGGCTGCGGAAGCTGCTGCTTCTGC
AACTCATACGATGGATGAACATAGAAGACTTCTATGTTCAGAGATTGAGCGCCTAAGACATTACAAGCAATGGAAAGACAAATGTAACAATCCATGCTCA
AGTCTGAAGAAAAGGTAATTAGATTGAGCAAAGAGAAGGATCAATTGCTGAAGGAAAGAGATGCTGCACTTCAGGAGGCTCATATGTGGCGCACTGAGCT
AGGGAAAGCTAGAGAGCAAGCAGTGGTACAAGAAGCAACTATTGCCAGAGTAGATGAGATGTTAAGGGCATCTGAAGCAGATGCTTGGGTGTACTGTCTC