Detailed information on CNT30101654


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693848Oryza rufipogonOryza sativa99.3775.93100634forward
CNT30576360Oryza rufipogonOryza barthii75.86100100484forward
CNT30116839Oryza rufipogonOryza nivara99.6999.8499.69636forward

Expression of CNT30101654

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MTIYMVHMYKYSAINMNWTRTESLFLALNIYFYNLRYHLLP*

>peptide 2 (31 aa)
MSISIEKGRQRGKRSELKRYSVPHFLLLPFP*

>peptide 3 (29 aa)
RFQSFVNCYKNLCVCTSLCLSPLSHREKS*

Sequence

>CNT30101654
AAAGGTTTCAGTCATTTGTTAATTGCTACAAAAACCTGTGTGTGTGCACTTCTTTGTGTTTATCTCCATTGAGCCATAGAGAGAAAAGCTGAGTGCGCGT
GCGTCGCCATTGTCGTGTCCACTACAATTTGCCACTTGTGCGTGTGTGCCATCGCTTGAGTTCGCTGCTCGCCGCGGAGCCTAAGTCAGGACTAGTCATA
CTGACATGCCAAGAGAAGACTGAAGCGAATCATGCATGAAGCGAAGCAATCGCTGATCCTGACATTGTCCCTGCCGGCAGAACATGTTCTCTGATACCTC
CTATGTCTATTTCAATCGAGAAAGGAAGGCAGAGAGGTAAAAGAAGTGAATTAAAAAGGTACTCTGTTCCTCACTTTCTCCTTCTGCCATTCCCATAAGA
ATCACCAAATAACATGGAATTCAGGCAGTGTTGGTTACTCTCTGTCAATGACCATATATATGGTCCATATGTATAAATACTCGGCAATCAACATGAACTG
GACAAGGACTGAGTCATTGTTTTTAGCCCTTAACATTTACTTCTACAACTTAAGGTACCATCTTTTGCCATAACGAAGAACTTAAGACTCCATTTTAAAG
GAAGATCAAGGGGCAAGACATTGAACCTTTTGTGTGGG