Detailed information on CNT30101300


BLAST search results

BLAST vs Swiss-Prot:
sp|O65660|PLAT1_ARATH, E-value = 2e-51

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524143Oryza rufipogonSetaria italica30.4741.5189.09220forward
CNT30442037Oryza rufipogonAegilops tauschii11.3625.6290.2482forward
CNT30243815Oryza rufipogonAvena sativa20.7850.3488.67150forward
CNT30596095Oryza rufipogonOryza meridionalis19.1151.69100138forward
CNT30116476Oryza rufipogonOryza nivara47.7853.82100345forward

Expression of CNT30101300

Peptides detected in this lncRNA

>peptide 1 (72 aa)
MRPPHRSRSRIRTPEPSAPSSVTPITESVPPFQIVPVRTYIVYTHLFSGSDDASATVIPSAAAAASSSVAANA

>peptide 2 (56 aa)
MHDSTSSRAVDHIRVRYIITRESKENLRFIYSTVTLGSSASAAAASLALLQLSTTA*

>peptide 3 (33 aa)
NWSEHRIVRPIQRWFHLITLLKSYNYFSILPSM*

Sequence

>CNT30101300
CCAACTGGAGTGAGCACCGGATCGTCCGACCGATCCAACGCTGGTTTCATCTTATTACCCTCTTAAAATCGTATAATTATTTTAGCATCCTCCCCTCAAT
GTAAAAAAAAGGATCAATCGCTGCAATGCACGACAGCACGAGCAGTCGAGCAGTAGACCACATACGCGTAAGGTACATAATTACACGGGAATCCAAAGAG
AATCTACGATTTATTTACAGCACGGTGACCCTCGGCTCGTCGGCGTCGGCGGCGGCGGCGTCCTTGGCCTTGTTGCAGTTGTCGACGACGGCGTAGAGGC
GGTAGGGCGATGCGTCGGTGGCGAGCCACTGCTCGACGGTGAAGAGCTGCTGCGCGCAGCCGAGGTAGTTGCAGTACCAGCCGTGGTGCGGGCCGGTGCC
GTCGGAGGTGAGGTTCATCCGGCACGGCGCCTGGCGCATGCAGGGGCCGCGGCCGCTGAAGATGTCGAGGTTGCCGCGTTCGTAGTAGTCGTGGCCGTCG
CCCATGAGGCCGCCCCACCGCTCCAGGTCGCGGATCCGCACCCCGGAGCCGTCGGCGCCCAGCAGCGTCACGCCGATCACCGAGTCCGTCCCGCCCTTCC
AGATCGTCCCCGTCCGCACGTATATCGTGTACACGCACTTGTTCTCCGGGTCCGACGACGCCTCCGCCACCGTGATCCCCTCAGCCGCCGCCGCCGCGTC
GTCGTCCGTGGCCGCCAACGCC