Detailed information on CNT30101268


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004176, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30576067Oryza rufipogonOryza barthii53.3689.8698.69381forward

Expression of CNT30101268

Peptides detected in this lncRNA

>peptide 1 (29 aa)
RTGAPPLRHHRRLAILVHLEPSRCAAKIA*

>peptide 2 (58 aa)
APERRRFGIIVVWPSSFISSQAAVPQRLPRLPPQDTSRITTRDTRNTENTSFSSSSPI*

>peptide 3 (74 aa)
THRSAAASASSSSGHPRSSRAKPLCRKDCLGFLLKTPQESPPETLGTRRTHPFLPRRRSEPVAIAIVNSFHSGP*

Sequence

>CNT30101268
ACGCACCGGAGCGCCGCCGCTTCGGCATCATCGTCGTCTGGCCATCCTCGTTCATCTCGAGCCAAGCCGCTGTGCCGCAAAGATTGCCTAGGCTTCCTCC
TCAAGACACCTCAAGAATCACCACCAGAGACACTAGGAACACGGAGAACACATCCTTTTCTTCCTCGTCGCCGATCTGAACCCGTCGCCATCGCCATTGT
CAATTCCTTCCACTCCGGTCCTTGAGCCATTCGAGCCGACGTCGTTCAACCCCGGAGAAACGCCGCCACTAGAATGATCCGCAAGCCGTCGCAGCCACCA
AGACCTTAACGACCTCGTCTGAGCCCTCGATGATTGCTTAAACGGTGAAGAAGTGATTTAGGTGCTGACTTTTTCCAGTTTCAAGGCAAGTCCCACCTCC
CTCTCTTTGATCACTTTGAACCTATGTTTTGGAGGTTATTGAAAATGTTTGCAAATCTTGCATGTCGATTGTACACTAATACATTAAAATCTTGTTAAAC
TTGTTAGACAAACTCCTATTATTTGCATTATCACCTTAACCCCACATATATCCATCTCTCTCATTCCTAATCTTAGGAATCATATCCTAATACTACTTGG
AATATGAGTTACATTGACACTAGTTCACTATATTTGCTTAGCCATGCTTAGAATAGTTTTACTTATCACTTGGGCTCATATTAACATGAAAAATGATTTT
ATTAAGTTCTGGAC