Detailed information on CNT30101200


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004636, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693281Oryza rufipogonOryza sativa10094.2299.84620forward
CNT30576128Oryza rufipogonOryza barthii73.8710099.13458forward
CNT30117048Oryza rufipogonOryza nivara95.1693.598.64590forward

Expression of CNT30101200

Peptides detected in this lncRNA

>peptide 1 (80 aa)
LDYSRSSQHCSNHGFASICSSTSDPARSAGASASATASSSSSRAGAVAAELRLAETVVEVLVLRLACSHAAAAAAHQSVS*

>peptide 2 (44 aa)
MASPLSALAPLIPPAPQVPVPVPLLPPPLPVPVPSPLNSGLQKL*

Sequence

>CNT30101200
CTAGACTACTCGAGGTCGTCGCAGCATTGCAGCAACCATGGCTTCGCCTCTATCTGCTCTAGCACCTCTGATCCCGCCCGCTCCGCAGGTGCCAGTGCCA
GTGCCACTGCTTCCTCCTCCTCTTCCCGTGCCGGTGCCGTCGCCGCTGAACTCCGGCTTGCAGAAACTGTAGTCGAGGTTCTTGTGCTGCGGTTGGCTTG
TTCTCATGCTGCTGCTGCTGCTGCCCACCAAAGCGTGAGCTAGGATACCTCTTCTGTAGCAGCGGTTGCAGCCTTGCAGGACTGAAGAAGGTGACGGGGC
TGAGGAATCAGTCATATATCCGCTGCTGATCGATGCATTGACGCTGTCGCACCTGCAGGCTATACTCTGTTGCGGATATATGATTTCTGTGTTTCTAAAC
CGTTAAGTCGTTAACTGTGTGCACTGTGGTGCTCCTTATAATTCTGTTCGTTTGAGTACCTGTGAATTGTGATGCATATCTGTGAATAAAAGGAAACGTG
CTTGCTAGCGTAGTGTGAGGAGTGTTCATTGACTCATTGTTCAACACTTCAACTCCTAACACAAGTTCCTCTTTATTGCTTATTTTTCACCCGTAAATAA
ATAAAACGCCATTATCTTGG