Detailed information on CNT30100826


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692359Oryza rufipogonOryza sativa36.9412.46100181forward
CNT30116319Oryza rufipogonOryza nivara10092.11100490forward

Expression of CNT30100826

Peptides detected in this lncRNA

>peptide 1 (35 aa)
PNGLDPNQIHGGGGRLHGAWRLIERRRARASRIVE*

>peptide 2 (33 aa)
KWSRSKPDPWRRGEAARRVEIDRATTSSGQSNS*

>peptide 3 (32 aa)
MIEGDNLEEVLQELEEMNFIKTMHSTYHAIRI*

Sequence

>CNT30100826
CCAAATGGTCTAGATCCAAACCAGATCCATGGAGGAGGGGGGAGGCTGCACGGCGCGTGGAGATTGATAGAGCGACGACGAGCTCGGGCCAGTCGAATAG
TTGAGTGAGGAGACACAACGGTGGAGGCAGAGGCGGCTCATGAGCTTGAATCTGGTCTTCCTCTTCCCCATCGATCCTGCGTCCATTGGAAAAGCTTGAG
AGGAGAGCAACATGCAACAGACAATAATCCTGTGGGTCTGGGGTTCAGCACTTCAAAACTGACGACCATTGTGAGAATACATAGGAGGTGCTAACTAAGA
TGATTGAAGGTGACAATCTAGAGGAGGTGCTGCAGGAATTGGAGGAGATGAACTTCATCAAGACAATGCATAGCACTTATCATGCTATTAGGATTTAAAA
AGAAAATTCATATAAGAGTTAGTTTGTAATCAATTTGTCTATATACTGAAATGACAATATTACACAATGTGTAAAATGCCTCTGCTTCTT