Detailed information on CNT30100816


BLAST search results

BLAST vs Swiss-Prot:
sp|Q32SG5|RIK_MAIZE, E-value = 1e-14

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692367Oryza rufipogonOryza sativa69.28100100787forward
CNT30369844Oryza rufipogonOryza glumipatula56.5199.5399.84642forward
CNT30105946Oryza rufipogonOryza longistaminata99.9159.1598.681135forward
CNT30575866Oryza rufipogonOryza barthii99.0359.499.731125forward
CNT30603883Oryza rufipogonOryza punctata29.9396.3290.88340forward

Expression of CNT30100816

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MLPKPSKPVLTNLDLCCEFWKNETKRLLHQIPLH*

>peptide 2 (62 aa)
MSLSENSLTCKTLMVEPISPTEKEGKNLTKLYLNLLRNYQISNSRNGKNAVLYEVFLWASTA*

>peptide 3 (95 aa)
ETDAPPGLTTLGSFEGNCAEYKFGGETELTSKDLGGAIGLFKSERLSSFLDISFEGNLGGGGGMLLGGGGSMFLGGGGGGGSMFLDADGCAETCG*

Sequence

>CNT30100816
CAGAAACAGATGCCCCACCAGGTTTGACCACTCTAGGCTCCTTTGAAGGTAATTGTGCTGAATACAAATTTGGTGGTGAGACTGAACTCACGTCCAAGGA
TCTCGGAGGTGCCATTGGCTTGTTTAAATCTGAACGCCTATCCTCATTTCTTGACATCTCATTTGAAGGAAACTTAGGCGGTGGCGGAGGCATGCTCTTG
GGAGGTGGGGGTAGCATGTTCCTGGGTGGTGGTGGTGGTGGCGGCAGCATGTTCTTGGATGCAGATGGATGTGCAGAAACATGCGGTTGATCTTGAAGAA
GCATCCCATTTGATCCAGGCTGAACTTTAATTGGAGGTTCAATCGATGAATTGGTCATGTTACCTAAACCGTCTAAACCTGTCTTAACAAATTTGGACCT
CTGTTGTGAGTTCTGGAAAAATGAAACAAAAAGACTTCTCCATCAAATTCCTTTGCATTAGAGTAAATAGTACACAATGAAATACAAATAAAGGATGAAA
TCAACAAAATTTGTGCATAAACAGCACAAATCCATAAATTGAAAGCATTATGACTGGTAAGCATCATACATGGATATCAGTTAACCATGCAGAGTTATAG
AGATTAACTTACATCTTTCTAAAGTTCATATAACTAAAGAGCATAACGGAAACTTCATAAAAAGTGTCTACAAAGAAATAAAGCAAAAGGTACTGCATTA
ATACTATTGTTTCATTAGGCTAAGAAGTTTCTGCTTTTCTAGGACTACTTGTGAATGTCACTGAGTGAGAACTCTTTAACGTGCAAAACTTTAATGGTTG
AACCTATTTCTCCAACTGAAAAGGAAGGAAAAAACTTGACCAAATTGTACCTAAACCTATTAAGAAACTACCAAATTTCAAATTCAAGGAATGGTAAAAA
TGCAGTCCTTTACGAAGTCTTCTTGTGGGCATCAACAGCTTGAACACAAAGGGTTAGTAACAAGATAGTACAAGCAGTCATCCACTTTAGAAGCAGAAGA
CTGTGCCTTGCTAATTCAATTTACGGGTTGAAAAACTCATGTAGTATCAAAAAATACAAGCAATAATCCAATTCAGAAGCAGAAGACTCTCGTCAGTTAA
ACTCCATTGGTGAAAACTCCAGCTTGTAACAAGCCC