Detailed information on CNT30100808


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691718Oryza rufipogonOryza sativa45.9228.52100231forward
CNT30252286Oryza rufipogonAvena sativa79.9291.5781.59402forward
CNT30132362Oryza rufipogonLolium perenne92.0543.9381.86463forward

Expression of CNT30100808

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MNSLIIFSCLFLFLQFIDPLCCKRVSFCTILMHKLHSIFSVNFTRFCIKDYKVWNTHHLIAFIKLGESLGV*

Sequence

>CNT30100808
ACCTTGTCTCCCTTGTTGGTGATTAAGTAGTCGCGGGTGGGTGTACCAAACAGACTATGAATAGTTTGATTATCTTTAGCTGCCTTTTCCTGTTCCTTCA
ATTCATTGATCCTCTCTGTTGTAAAAGGGTAAGCTTCTGTACCATACTCATGCACAAGCTCCACTCCATCTTCAGTGTAAATTTCACCAGATTTTGCATC
AAGGATTACAAGGTGTGGAATACCCATCACCTTATAGCGTTCATTAAGCTTGGCGAGAGCCTCGGAGTCTGAGAAGGGGACTGCCAACCAAGGCATCTTT
GCAAAGTAGGCATTGAATGCGTCTTGATCACTATCCCCTGAAACAAAGACAACCTCAAAGCTCTTTCCCTGGGAGACCAGCTCATTGTATGCTTCAATAA
GCTTAGGCGTGAAGCGCCTGCATGGTGGGCACCATTGAGGCCGAGAAGTAGAACGGCAACGGTGCTTGCCTCGATGCTGCTGATCTTCACCTGCAGGACA
ATA