Detailed information on CNT30100753


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691875Oryza rufipogonOryza sativa92.3255.47100421forward
CNT30553102Oryza rufipogonOryza glaberrima92.7696.36100423forward
CNT3067165Oryza rufipogonLeersia perrieri81.58101.9284.95372forward
CNT30595975Oryza rufipogonOryza meridionalis84.8798.9898.19387forward
CNT30575871Oryza rufipogonOryza barthii94.9691.93100433forward

Expression of CNT30100753

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MKTGIHYDTLSDVRLQVSEALTRCICALHDLISFLV*

>peptide 2 (59 aa)
ITSEFKLQQLQSQSQILTVPKKCNNCILTEGMGWHIYTVPYNNHLQASLARSKHKNEWA*

Sequence

>CNT30100753
CAATCACGAGTGAATTTAAGCTGCAGCAATTGCAATCACAATCACAAATTCTGACAGTACCTAAAAAATGCAACAATTGTATATTGACAGAAGGAATGGG
CTGGCATATTTACACTGTTCCATACAATAACCATTTGCAGGCTAGCTTAGCCAGGAGCAAGCACAAGAATGAATGGGCATAGCTGCGATTTCTCCCTAGA
GAAACTAAATTGCAGGTTAGCCAGGAGCTAACACATGCATATGCCATGAAAACTGGAATACACTACGATACTTTGTCGGACGTGCGCTTGCAGGTTAGCG
AGGCGCTAACGCGGTGCATATGTGCACTTCACGACCTTATTTCTTTTCTCGTTTAAATTTGGGGGAGGTGAGGTCAATTAGGTGTTGACCTGGATTTCCC
CCAGAGAGTATGGACAGTCTGATGGGTTCTTCACTTCTCGCAGAAGTCGAGGAACC