Detailed information on CNT30100709


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006112, E-value = 2e-162

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30109401Oryza rufipogonOryza longistaminata10043.6996.67360forward
CNT30551432Oryza rufipogonOryza brachyantha48.898.8486.36176forward

Expression of CNT30100709

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MEVLCAYGMRRRIWKESKFGTIGYVKFVSCTRGFPKVFRTLSMSLVRGFRLPTSCINRGGA*

>peptide 2 (33 aa)
GDLMPRESICGDGSGVGLGIRRRPWWLEIMRDT*

>peptide 3 (34 aa)
MTYDGGIVCVWDAETNLEGVQIWYDWLCKVCFLY*

>peptide 4 (32 aa)
MEIPYDIRWRYCVRMGCGDEFGRSPNLVRLVM*

Sequence

>CNT30100709
GGTGACTTGATGCCTCGGGAGAGTATTTGCGGTGATGGATCGGGAGTCGGCTTGGGGATAAGACGACGTCCGTGGTGGTTAGAGATCATGCGGGATACTT
AGGTTAGAGTTGATGCACGTGGTTGATGGAGATTCCATATGACATACGATGGAGGTATTGTGTGCGTATGGGATGCGGAGACGAATTTGGAAGGAGTCCA
AATTTGGTACGATTGGTTATGTAAAGTTTGTTTCTTGTACTAGAGGGTTTCCTAAGGTGTTTAGGACTCTTAGTATGAGTTTGGTTCGTGGCTTTAGGCT
GCCTACCTCATGTATAAATAGAGGGGGAGCATGAGGCTTCCCGGTATCGCTTTTGAGAGC