Detailed information on CNT30100642


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678686Oryza rufipogonSetaria viridis13.7924.1485.7184forward
CNT3045395Oryza rufipogonPrunus dulcis20.8516.8981.1127forward
CNT30185816Oryza rufipogonSecale cereale25.7839.8585.99157forward
CNT30296517Oryza rufipogonTriticum aestivum25.7855.8786.62157forward
CNT30223753Oryza rufipogonHordeum vulgare20.8547.0488.98127forward
CNT30683583Oryza rufipogonTriticum urartu15.7624.1893.7596forward
CNT30575864Oryza rufipogonOryza barthii51.2346.5799.68312forward

Expression of CNT30100642

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MFNCAMRKDISCNRFMVMTYNFSTETQTFMHHPAHMSS*

Sequence

>CNT30100642
ATACAATAACACCATTTAGCAACCAAAGCACGACTATCAAAATTACATGATAAAATTATTATTGTCTTGAATTATGTAAACGATGATAACAAATCCTTTT
CCAGCTACAAAAGAACCAGCATAACAACAAAGAATTATAAAGTTGCTTAAGTAATCTCTCCCTTCATCTCAAAAAGAGCTATATCTAGGGGGCCTAGGCC
ACAGCAACACTTTCACTTAAAGGGTACTTTCCATCCTGCGACACACAAGCTCCCAGGATCAATCTACTTGGCCTTGCCGTTCTCGACAGCAGCAGTCGAG
GGGTTCAGCTCATCCCAGGCTCAGGTGGTCACAGATGACCTAAAGTTTCAAGAATTAATATTAATTATTATTTTGTGAATGGAATGTTCAACTGTGCAAT
GAGAAAAGACATATCATGTAATAGATTCATGGTAATGACTTATAACTTTTCGACAGAAACACAAACCTTCATGCACCATCCAGCCCACATGTCGTCGTAG
CGACCAATAGGCTGGCCATCACCCATGAGACCAAAGTACATTGCAGGACCGATGAGATCACGGTCAAAAGCAAGGTTCATGCCACACATGGGGAACAAGG
TTCCCTTGG