Detailed information on CNT30100635


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696336Oryza rufipogonOryza sativa15.0310093.1319forward
CNT30595550Oryza rufipogonOryza meridionalis14.61100.6596.77310forward
CNT30575578Oryza rufipogonOryza barthii31.3471.7498.35665forward

Expression of CNT30100635

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MEARPNSTYPAPNLILISIFPAPHVSFYQCKNK*

>peptide 2 (33 aa)
MLEGLSCNLFVAWISILIWRHARTRPTQPPTSY*

>peptide 3 (51 aa)
MAPTFAASVPKRKDLNNMCATHHVAYHSIYTFRYRRGFCLAASLLPCLIRG*

>peptide 4 (41 aa)
MSHSINAKISSKLSLMLFGTGTSFWISRHVGSLYHVTHVME*

>peptide 5 (75 aa)
MRDLTNQRPLVPISCCFHSTSSVTPHLNLRDTVGGLKLLENQRTSLSCLTSESLPSSTNRFMLFIGVHTTTHHIF*

>peptide 6 (59 aa)
MEKTPPSAPHYNELLNIMSLSRGSFTKVVQCSICFRFSPNPLKVSTSAFRTLAAAIRHA*

>peptide 7 (95 aa)
VIGNRETTSMGCACARLTGAAGRSTCDVVGSRRPTSSMGYAAAESMGAAGRSTCIVAGSCRPTSSMGCAAAESTGAADRSTCIITGSRRLTSVGC*

>peptide 8 (41 aa)
MRKAVPSSSLVPRLYFNWSKKLLRVCLVNAKIRSLIEIGTM*

>peptide 9 (34 aa)
MNPYFHLFRRTYFLVIHIFIHLCLIFLLYFKEPI*

Sequence

>CNT30100635
CCGTCATCGGGAACCGTGAAACGACCTCCATGGGCTGCGCCTGCGCCAGATTGACAGGAGCCGCCGGCCGCTCCACTTGCGACGTCGTCGGGAGCCGTCG
ACCGACCTCCTCCATGGGCTACGCAGCCGCCGAATCGATGGGAGCCGCCGGCCGCTCCACCTGCATCGTCGCCGGGAGCTGTCGACCGACCTCCTCCATG
GGCTGCGCAGCCGCCGAATCGACAGGAGCCGCCGACCGCTCCACCTGCATCATCACCGGGAGCCGTCGACTGACCTCCGTCGGCTGCTAACTTGCCATAT
TTGTTCTTCAGATAGCTTAATATGGAGAAGACTCCGCCCTCCGCGCCTCACTATAATGAACTGCTCAACATAATGTCTCTAAGCCGTGGATCTTTCACTA
AGGTGGTCCAGTGCTCGATCTGCTTCAGGTTTAGTCCTAATCCCCTGAAGGTCTCAACGTCTGCTTTCAGAACGTTGGCAGCAGCGATCCGCCATGCGTG
ACCTCACCAATCAGAGACCTCTTGTGCCCATATCCTGTTGTTTCCATTCGACGTCCTCAGTAACTCCTCATCTGAATTTAAGAGACACAGTTGGAGGCTT
GAAGCTGCTAGAAAACCAGCGTACATCCTTGAGCTGCCTAACAAGTGAGAGTCTTCCTAGCTCAACAAATAGGTTCATGCTTTTCATCGGAGTGCATACA
ACCACCCACCATATTTTTTAATCTTGCTCTGTAGGACAGGGCTAATCCTGGTGATAATAAGGTTACGGATGGCGCCCACGTTTGCTGCCTCTGTGCCAAA
ACGAAAAGATCTAAACAATATGTGTGCTACTCATCACGTGGCTTATCATTCAATTTACACTTTCAGATACAGAAGAGGTTTCTGTTTGGCTGCTAGCCTG
CTACCTTGCTTAATTAGAGGATGAGGCTGCAGACAGTTTCTTACAAGAGGTATGCAACGGCGCATCTGTATGCATAGGTTTCTCGGTTAGAACATTCTTT
TTTCTTTCACCCAACTCGACCCAATAGGTGTAAATATGTATCCTTCTTTATAACATGTTAGAGGGATTATCTTGTAATCTGTTCGTCGCCTGGATAAGCA
TATTGATATGGAGGCACGCCCGAACTCGACCTACCCAGCCCCCAACCTCATATTGATAAGCATATTTCCTGCACCTCATGTCTCATTCTATCAATGCAAA
AATAAGTAGTAAACTTTCTTTAATGCTCTTTGGAACTGGTACTTCCTTCTGGATTAGCCGACATGTAGGCAGTTTGTACCATGTTACTCATGTGATGGAG
TAAATGGAAATAAGTATTTAATATTATTTTGCATTTTTAGTCGAAAAAGTTTATGTATAACTGTTAATTGCCTTTTTGAGGTGGCAATTTAACTATGCTC
ATTGATTTTTGCGAATTCAATAGGTTTACTGTTGAAAACTACTATTGCAATAATTTGTAATTGTTCTGATGAATCCATATTTTCATCTATTCCGAAGAAC
ATACTTTTTGGTCATCCATATTTTCATCCACTTGTGCCTTATTTTTTTGCTCTATTTCAAGGAGCCCATTTAATAGCTTGCAGTACAACTCCACTATGAA
ACGTAGTCTAAAATATAATTGTCCATTTTAAGTTATGATCATTCTTGCTTGATCCTTTTCCATAATGTATATTTATTGCTGCCATAAATCGCAGTGCCTA
TAAAGTATTTCTTTATCTGTGATTGCTTGGATTTTATTTTGGTATGTCTTGTGTGGACAAATATGTGCAGCAAAGAAATATGCAAGAAACGACGTGGCCA
TGAGGAAGGCGGTGCCTTCCAGTAGCCTGGTGCCAAGGTTGTATTTTAATTGGAGTAAAAAGTTGCTGAGGGTGTGTTTAGTTAACGCCAAAATTAGAAG
TTTGATTGAAATTGGAACGATGTGATGGAGTAAAAAGTTGCTGAGGGTGTGTTTAGTCCACACCAAAATTAGAAGTTTGATTGAAATTGGAACGATGTGA
CGGAAAAGTTGGAAGTTTGTGTGTGTAAGAAAACTTTGATGTGATGGAAAAGTTGAAAGTTTGAAGAAAAAATTGGGAACTAAACCAAGCCTGAATCTAG
CCGGTTCTGGTCTCAGTTTTCT