Detailed information on CNT30100592


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553099Oryza rufipogonOryza glaberrima87.0388.3498.613744forward
CNT30106819Oryza rufipogonOryza longistaminata3.628.6583.23155forward
CNT30575904Oryza rufipogonOryza barthii90.68101.1497.773901forward

Expression of CNT30100592

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MINKVEHSWISYLIIVVNQETNSANPEVHFK*

>peptide 2 (32 aa)
MDYCLWMAMLFNKMKRLNIMKYYFLDPIKLQM*

>peptide 3 (34 aa)
MYLAFESYMAAQYLHTISECWVKVSNYFKDKLDI*

>peptide 4 (37 aa)
MPSSPLVTSMRPRPKLIFRTSIRPCNSREEARPTATF*

>peptide 5 (37 aa)
MGLVPFYQSRTGLLLGESNNFHLAHSFRYFSEQIIFL*

>peptide 6 (40 aa)
MAICIALHLEAMSPQLLSTIFLAPPPFSFKVKLKISFESL*

>peptide 7 (39 aa)
MINLPCFIGVEIGGSIVGLFLLSFQVYLSRTVCCRRGRC*

>peptide 8 (45 aa)
MVSNKNVLSLPISLFPPHFSMVVWVWSPFISQGQDCSWASQTIST*

>peptide 9 (55 aa)
MNFFFNILLLLLLLSDISHSVLSAGQLCSYASDMLTLQLLYYRLCDSVLVKLDAY*

>peptide 10 (47 aa)
FPAPLLSRALSLAHAAASSSSSRLPPPLRRAANSPHCVAAAAPPALF*

>peptide 11 (63 aa)
MERSGSCLKSCRDRSPGYRAASRNVNHGNLHSPSFGSYVPPTIEYYFFSSTSLFIQGKIENII*

>peptide 12 (42 aa)
MKNTRVYDGVYRRVAQLLARHLSPFETKYLFILYSTRYLFSE*

>peptide 13 (66 aa)
MLWWSCGGGYPLLVIKVLNLLGFSIAQNCIFPLLKIAGNKFDSIGQYNLLVMLCKMLCQIHEYYPH*

>peptide 14 (73 aa)
VPRSSPLSRALPSPRRRLLLLLAPPAPATPRRKLSSLRRRRRASRTLLAPRCITAPPSCHREAGSGGGEVVPA*

>peptide 15 (74 aa)
MYCPSPYLCFPPIFPWLYGFGPLLSVKDRTALGRVKQFPLSTFLSLFFGANHFSIKNALPYSTPLLTSQHTLFM*

Sequence

>CNT30100592
GTTCCCCGCTCCTCTCCTCTCTCGCGCGCTCTCCCTAGCCCACGCCGCCGCCTCCTCCTCCTCCTCGCGCCTCCCGCCCCCGCTACGCCGCGCCGCAAAC
TCTCCTCACTGCGTCGCCGCCGCCGCGCCTCCCGCACTCTTCTAGCACCCAGGTGCATCACCGCACCTCCCTCTTGCCACCGCGAGGCAGGTTCTGGTGG
AGGGGAGGTCGTGCCCGCCTGATCCGGCAACCACGATCTCCCTGCCGGCAGATCCGATCACCCGGAGGCTTGGGATGGTTTAGCACATGATGCTCATCGT
TTTCTCTATGGGGAAAGACTTTCCTCCCTAACTCTTTTTTTTTGTTCTTGCTCTCCCTCTCTCTCCCTCTAATCTAGATCCAGAGCCGGTGGGGAAGTTG
GATGTGACAGATCAAGGCCGCCGGATCTGTTGAGCTCAGCAGCGGCAGCAGCTTGGCGATGATGGCAGCAATGTCTCAGACATGCCCTCCTCCCCACTGG
TGACAAGCATGAGGCCACGGCCGAAGCTTATCTTTCGCACCTCCATCAGACCTTGTAATTCTAGGGAAGAAGCTCGGCCAACTGCGACCTTCTAACGCAG
GGAAGGATGGAAAGGAGTGGCTCCTGCTTGAAGAGCTGCAGGGACAGATCGCCAGGATACAGGGCAGCCTCGAGGAATGTGAACCATGGCAATCTGCATA
GCCCTTCATTTGGAAGCTATGTCCCCCCAACTATTGAGTACTATTTTTTTAGCTCCACCTCCCTTTTCATTCAAGGTAAAATTGAAAATATCATTTGAAA
GTTTGTAAAATACTATGTATTTGGCGTTTGAATCCTACATGGCTGCACAATATTTGCACACTATCTCTGAATGTTGGGTAAAAGTTAGTAATTATTTTAA
AGACAAGCTAGATATATGAAGTTTTTAAAATATAACCTCTATTATTAGCTATTGGTTCTCGCTGGTAAAGCAAGTATACAGTTAATCAATCTGGGCACTG
CAACCTTAAAGCAAAAGTTTTCCTTACTTAGTTTTCCTTACTTGTTCTTGCTTTTCTTCAAATTAAGTTGAAATCTAAATATTCATCCAGTGATTTTGGA
AGATGAAAAACACTCGTGTGTATGATGGAGTTTATAGGAGAGTAGCACAGTTACTTGCAAGACATTTGTCCCCTTTTGAAACAAAGTACTTATTTATTTT
ATATAGTACAAGATATTTGTTCAGTGAGTAGATAAAAATCCAGTTTGTTGTGAAGGCTTCCAAATGGGCTAATTTTGCACTATATGATTAGCCCTTTGCT
TATATATGAACTTTTTTTTTAACATTCTCTTGCTGTTGCTGCTGCTTAGTGACATTTCTCATTCTGTGCTTTCAGCAGGGCAGCTTTGCTCTTATGCAAG
TGACATGTTAACACTGCAGTTGTTATACTATAGGCTGTGTGATAGTGTGCTGGTCAAGTTGGACGCATACTAAATGTTTGTGATCTTTTGATGATTAATT
TACCTTGTTTTATAGGTGTAGAAATTGGTGGAAGCATAGTTGGTTTGTTTCTGCTCTCATTTCAGGTCTACTTGTCCCGTACTGTTTGCTGCCGGCGTGG
ACGCTGCTGAGTCCCCACACATCAGCCACGACTAGAATCCTGGAATAGTCGCTACCATATATATGGTGTTTGCTTCCTAGAATCCTTTTGCTTTACATAA
AACTGCAATCCAGACTATGAACAAACACTTATGGTTCAAATCCTATAACCCTTAATTATTATTACCCTAAATGTCTACTGCTTTGATATGATCCTTATCT
TCAGCTTAAACATATGCCATGAAAAAAAAATGCATGAGGTAACTCTCAGCCAACTATGGTTTGCTATCCTCTAGATGGAAAGGTATAGCTGGGGTACATA
TTTGTAGCTAATCTGGGATGAGCTACATTTTTTTTCCAGCCTGATTCATGTCTAGCAATGTAAGCTTTATAAATATTTGATCTTAGTCAATCTTGTGGAA
ATGGTATTATTTTGGCTTAATTTTCCTTTCTTATCTTTCGGAATAACATAGCTTCCTGATCACCAAACTGCTCATGCTCCTTGATTAGAACATAAATGGT
TAGTAATAAAAATGTATTGTCCCTCCCCATATCTCTGTTTCCCCCCCATTTTTCCATGGTTGTATGGGTTTGGTCCCCTTTTATCAGTCAAGGACAGGAC
TGCTCTTGGGCGAGTCAAACAATTTCCACTTAGCACATTCCTTTCGTTATTTTTCGGAGCAAATCATTTTTCTATAAAAAATGCTTTACCCTACTCTACT
CCACTACTAACATCTCAACACACTCTGTTTATGTGAGCAAACATATATAAATTATGTGTACAACCGTACCTCTCACATATGTAGTTTTTTATCTGTAGAT
TAATTGAATATGCACATGAGAATTGCTTGATTAGGCCTGGTGTTATGGTGCTGAATTGCTGATTGAAAAGCTGGTGATAATGTTGGTATCGTTTTGGTAT
TAGTTCATATTTTAGAAAGGTTGCAAGCTTATTGCTATTATGTTGGCTTAATACTCACAGGCAGATGTTGTTTTTGCATGCCAAGTGATATTGATAGGTG
CTAAGCTCTTGGAAATTGTTACAAACCAGAAACATAATTACCTCATTCAGTTTTTCTACAATAAATATTTTTCTCTTGAATGACCAAAATTAATTCTATG
CCTTCTTTTTGCTTAATTGTTGATTACACATTTATGCTAAACTAATTACTGCTCTTTCTGTGACATTTTAAGCATCCTCTGACAAGTGTTAGGTAGAGCC
TGCTTTCATTTGCCGCAGATCGGGTTTAAGTGTATGATCAACAAAGTGGAACACTCATGGATATCATACCTAATTATTGTTGTTAACCAGGAAACGAACT
CGGCAAATCCAGAGGTACACTTCAAATGATCTGAAAGTGTCGACACCTAAGATTTTGAAGCACACAGCTGACAAAGTGGACATGGTGTAACAATTTCTAG
AACAAGATGCACCATTTATAGAGAAAAATGTAGTACACGTATTCTCATAGCAGTCCTAGGAGTGCAATTGATTTTTTTACATGGATGAAATGGAAGGCAC
GATACTCTGTTCCTGTGAATGAATTGAGACCATCCTAATGTTGGTTTGCACAGTTTGATCATGCAAAGTTATAGAAGATGTTGTGGTGGTCTTGCGGAGG
TGGGTATCCATTACTGGTGATTAAGGTGTTAAATTTGCTTGGATTTTCCATTGCTCAGAATTGTATATTTCCATTACTGAAAATTGCAGGCAACAAGTTT
GATTCCATTGGCCAATATAATCTTTTAGTGATGTTGTGTAAAATGTTATGTCAAATCCATGAGTATTACCCACACTAGAACCAAATTTGTGCCACAATGT
GTTGTGATTATTGCTGAGGCATAGAATTTATTTGTAAAAAAAAATGTGTTATTAGCTTGACAGAAGAAAAAAACTACCAGATTACGTTTTATAGGATAAA
CATTGAACTAATTTGTTTAGTATGACATTTTGTTGAAGCTATCTTTTTCTTAATGACTTTGGAAGTAATGTAGTGTTTCATAACTAATTACAATACCTTC
AATGAAGAGATTATCGTCCTAATGCTTTTGTTTCATGTGCACTCTATTGCGTTAAAAAAAGAAGAAGTGGAACCTGAAGAACTTTAGAGGACCTCGCTTG
GCCAGTTGGCCTGTCTGTGTCATTATAGCTTCTCACTTACAGGCAACCAAGGTCTCTTCATGGATTATTGCTTGTGGATGGCCATGCTCTTCAACAAAAT
GAAAAGGTTAAATATAATGAAATATTATTTCCTTGATCCCATAAAGCTTCAGATGTAGAGTGTGAGCTTGCTGCCCTGTGAGCTAAAATTCCATTTTTTT
ACATATTCCTATTGTACTATTCATGGCTGCTTTATAATTGATGTGCTTTCGTTTGTAGAGTGTGCTTGAATTATTAATCAAATAAGCAGATTTACTGTAG
GAATTCATGTAAGCATATTTTATAAACATCACTAAACTTGCCATTCATCTGGTCCAAGGAGGCCATCGCGTCCATGGTGTTTTACTCCTTGAGTGGACGG
CTTTTACGCTATTATAAACATAAAAATGGATTTATGGAAGTCTAGATTTCCAACTGTAAATTTTTGTGCTATTCATCATCAAAGTTCATAGTGTATATTC
TGTTATGTGTAATTCCTACTGTATTGTTCATGATGTTAAATTAATTATAGAAGTTTAATAATGTTTGGACATGTTATATTGTAAATTGAGATTTAAAATT
TT