Detailed information on CNT30100574


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30575210Oryza rufipogonOryza barthii91.2661.8494.68470forward
CNT30115465Oryza rufipogonOryza nivara97.8649.0394.84504forward

Expression of CNT30100574

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MYHVLRSIKDQNLLKLDLKQIIERSNPHHDLKHPYPYYKKTQQHASHDISKNTNE*

>peptide 2 (54 aa)
DQHLRSTCPNSLKTRSGAFLQDIESLHCIIYQCLHQNPTHIDLRDKTGKNYYSH*

Sequence

>CNT30100574
TGATCAACATCTCAGAAGTACATGCCCTAACTCACTGAAAACCAGAAGTGGAGCTTTCCTCCAAGATATAGAGAGTTTGCATTGCATCATTTACCAATGT
TTGCACCAAAACCCAACCCACATCGACCTTCGTGATAAAACAGGTAAAAACTATTATTCCCACTAATCCAAAAATAACCTAGTCTCTCACATTTGCAACT
TTTTTTTTTTGGAGAAATTGATGTATCATGTCCTTCGTAGCATAAAAGACCAGAATTTACTCAAACTAGATCTGAAGCAAATAATAGAACGCTCAAATCC
GCATCACGATCTCAAGCATCCATATCCATACTACAAAAAAACACAGCAACACGCATCACATGATATATCTAAGAACACAAACGAGTAGGGAAGAAACAGC
GAAGCCACCGGTCAGGGAGGGGTAGCAGGATCAGATCAGTCGTCCCGCTTCTTGAGCTTGTCGACGCGCTGCTGGAGCTGGTCGAGCCTGACGACGAGGG
AGGTGACGGAGAAGA