Detailed information on CNT30100560


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369556Oryza rufipogonOryza glumipatula88.9199.0799.661170forward
CNT30110893Oryza rufipogonOryza longistaminata63.83101.3392.98840forward
CNT30575145Oryza rufipogonOryza barthii66.9569.0499.43881forward

Expression of CNT30100560

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MCGQYHKPLIIYTLWPRAGSYIGQFKVFFCPRLLTNKTE*

>peptide 2 (91 aa)
MSTSSTWYDDQFQVISRNGDLPHKIFVEQEYVRCPGYVLVHGKSFPRPIITLWYHKFTTPETDRDKARSTAAHCVHFLFHRQYIFTLKRIM*

>peptide 3 (65 aa)
MYASSISAPVDLDLVIRFVFFFFPLRLKKKQRRSRSLCVALSLTSYVLLVRSSSEFALQTCSVCL*

>peptide 4 (64 aa)
MHGFVDSLVHLRCGCNRSSFLSCMLLRSLLPLTSISLSDSCFSFSLSALRRSKGGRVLFAWLCR*

>peptide 5 (63 aa)
THLPDPKYILRFNTALAASSHSPHLPVFQASSSSFFSLTIYPDYALGLLIATSRILGVVVVCR*

>peptide 6 (51 aa)
APTRSKIYPSLQYSTSSFISFAPSSSLPGVQLQFLLIDNISRLCSGLANCY*

>peptide 7 (44 aa)
MNLFCCWSSSYPCMPGDWRIIDDAAVGLLALGHAWLDDHQQTSS*

Sequence

>CNT30100560
ACGCACCTACCCGATCCAAAATATATCCTTCGCTTCAATACAGCACTAGCAGCTTCATCTCATTCGCCCCATCTTCCAGTCTTCCAGGCGTCCAGCTCCA
GTTTCTTCTCATTGACAATATATCCAGATTATGCTCTGGGCTTGCTAATTGCTACTAGTAGAATACTAGGGGTGGTCGTGGTGTGCAGGTGAGATTATTG
CTACCCATGAACCTGTTTTGTTGCTGGTCATCTAGCTACCCGTGCATGCCTGGAGATTGGAGAATAATTGACGATGCAGCAGTCGGCTTATTGGCTCTTG
GGCACGCGTGGTTAGATGACCATCAGCAAACAAGTTCGTGAGACGCATGCATGGTTTCGTCGATTCTCTGGTTCATTTGAGGTGCGGCTGCAATAGGAGT
TCCTTTTTGTCATGTATGCTTCTTCGATCTCTGCTCCCGTTGACCTCGATCTCGTTATCAGATTCGTGTTTTTCTTTTTCCCTCTCCGCCTTAAGAAGAA
GCAAAGGCGGTCGCGTTCTCTTTGCGTGGCTCTGTCGTTAACTAGCTACGTCTTGCTGGTTAGGAGTAGTTCTGAATTTGCATTGCAGACTTGCAGTGTG
TGTCTCTGAAGACGACGCTGCAAATCGCCGTCTCCGTGTGCTTAATTACGACAGGTTTGCAAGGAACAGCGGCTGTTGATGTTGCTGATCGTCAGCAATT
CCGTGTTTATGCGTGTCTGATTGCAGGAAAAATGAGTACTAGTAGTACCTGGTATGACGATCAGTTCCAGGTCATCAGTAGAAATGGCGATCTTCCACAC
AAGATTTTTGTAGAGCAAGAGTACGTTCGATGCCCTGGATATGTTTTAGTACATGGTAAATCTTTCCCTCGGCCAATAATAACGCTGTGGTATCACAAGT
TCACAACCCCGGAGACTGATCGAGACAAAGCAAGGAGCACAGCGGCACATTGTGTTCATTTTTTGTTTCATCGACAATACATTTTCACCCTGAAAAGGAT
TATGTGAACGGAGCTTCCAATGTAAATTGATACATGTGTGGTCAATACCATAAACCTCTCATAATTTACACGCTTTGGCCAAGAGCAGGCTCGTACATCG
GCCAATTCAAGGTGTTCTTTTGTCCAAGATTACTTACGAACAAAACGGAGTAAAAAATATATGTCCCAAAGGTATCCTTTTTGTTTAGTTTTTGTTTTTA
CAACTACTTAGAAGACGCATATACGCGCGCTTACACCACTACCTTACTTAGATATCCTTGAATGCACCACCTTAACACAGACAAAGATCAACAACACATC
CATAGCCTAAAATTGG